ELF(0434 (%"p 444444, , , , , Pb:8 8 8 PPP Qtd/lib/ld-linux-armhf.so.3GNU @ #AY0@pEDQ‰P"% ` @  ` "BH !B 8`5`@:(L Daг $Y$B1 TFAƊ @@0&0 "I  D  !"#%(*,/12359=>@ADEGHIJKLMNOPQSTX[\]^`cfgijknprtuvwxy|}!th=WӦu } qWT /t|Zv^BY ֔v@! ֽv|Q8D`9/[;#2|?fUa/t:|w|Bl_؄vכ|Kn~h%u +kݦC1 mC"Qr~9@ 8f&"O: O۝|,8R)%V6d8!/ՕM|3u&v;o<|=@y U W5Fi lwtIFu EC f9N- i0%lFmU\vzNV zV+d|AFh*>f#Uq 9hd9F{u( 4ݵ MMm dF5&YuF$ @$a1Ͷ }u`T m FT%~d8? T ,m 2$ Y &d>%͐ ُ  k1libm.so.6_ITM_deregisterTMCloneTable__gmon_start___Jv_RegisterClasses_ITM_registerTMCloneTablefmodlroundflibrt.so.1clock_gettimemq_openmq_getattrmq_receivemq_closemq_unlinkmq_sendlibpthread.so.0sigactionpthread_attr_initsiglongjmprecvfrompthread_mutex_unlockpthread_createraisesendtopthread_attr_setstacksizewaitpthread_attr_getstacksize__errno_locationforklseekconnectnanosleeppthread_attr_setdetachstatepthread_mutex_locklseek64acceptpthread_exitrecvsystemfcntlpthread_mutex_initlibc.so.6socket__xpg_basenamefflushstrcpy__rawmemchrgmtime_rreaddirfopenstrncmpstrrchrcfmakerawperror__isoc99_sscanfclosedirinet_ntoaftellinet_ntopstrncpyputcharlistenmsgrcvselectmkdirreallocabortstdinstrtollvsprintfpopengetpidstrspnstrdupinet_ptonlocaltime_rstrtodstrtokstrtolmmapcfsetispeedfgetscallocstrlengetaddrinfomemsetstrstrstrcspntcsetattrbindfseekchdirmemcmpgetsockoptmsgget__fxstat64vsnprintfpollgetpwuid_r__sigsetjmpstdoutfputcinet_addrfputsmemcpyfcloserandstrtoulsetsockoptmallocstrcatstrcasecmpremovegetpeernamegetgidopendir__xstat64__ctype_b_locgetenvstderrioctlalarmmunmapmsgsndgetuidfreeifaddrsstrncasecmpgetifaddrsif_nametoindexfilenopclosegethostnameusleepchowngetcwdfwritefreadgettimeofdaygeteuidatoftcflushstrchrgetsockname__strtok_rqsorttcgetattrtimes__ctype_toupper_loc__ctype_tolower_locfreeaddrinfo__xpg_strerror_rcfsetospeed__xstatmemmovefopen64strcmpstrerror__libc_start_mainstpcpyvfprintfsysconffreebananapiValidGPIObananapiwiringXLoghummingboardhummingboardSPIDataRWorangepiradxaradxaValidGPIOraspberrypiValidGPIOci20SPIGetFdplatformshummingboardSPIGetFdradxaAnalogReadraspberrypiSPIDataRWorangepiValidGPIOraspberrypiSPIGetFdhummingboardValidGPIOhummingboardSPISetupraspberrypici20SPISetupci20SPIDataRWgpioraspberrypiSPISetup_fprintfci20ValidGPIOci20GLIBC_2.4GLIBC_2.7q ii  ii  0ii ii ii  N  N # ?D cH L P (T X 1\ 9` d h kl lp 3t /x ]|  y ) ` %   O , :  I  j t A  Qĕ .ȕ r̕ }Е ԕ ؕ 5ܕ ^  R     &  ; q  X     $ E( , 0 4 P8 x< L@ D H L P T X \ @` id h nl p t x |   T \  * Y  v _   u   "  Ė zȖ ̖ UЖ 7Ԗ ؖ <ܖ   2  8 >         M   J$ ( a, '0 {4 G8 d< H@ +D H  L P T ZX \ ` d Vh !l |p ht x | f  e F ~   D  b  $ W  C   =ė ȗ o̗ KЗ ԗ ؗ @--q ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxxGFƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ|ƏʌtƏʌlƏʌdƏʌ\ƏʌTƏʌLƏʌDƏʌ<Əʌ4Əʌ,Əʌ$ƏʌƏʌƏʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxGFƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌxGFƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ@-h< $ p@-I0$ƔD \(6" < \ \^PP ?o2^0S \0 D`j(P 00 }+0(P+0P (&p  PC @P/ P= @PGDP/ P/P>1 P/P,  P* 5 P/ P%  P/.P( P!  P  P #P/P PP P/P P/P P P/  / ///////U@-@רD?@ӨhgNO8@-@  20  8@-d .0@蒪x9|<0 -M 0 + 偪Ѝ|<FF걚P /@- ըQ@- D0 @ <@b  0 0@VPC P@- P @44 FT  墨Q/@- 0S0@L 8@-PP@ R ڌ|| P0\0 S0 80 @D8 00 $ 08 HX0pQ/@-BM B_@P K d9PXXߩBߍ,= 0 ((崫 ̩b |Q/@-BM _@P K d PXX屩Bߍ,= 0n ((冫 垩b ,|Q Q/@-@0P  @ \W\@\b G-PPMp@P& Pᣳ1 0P1 @T_  `P/0, h1 tvPЍβWP@`L=@P  TV/ 㲲 P!ֲ㪲 @ ʲ㞲Ptἲ㕲 x@Ṳ@ 40Pg @T$<PЍX^ , ' PDx<dld pQ/lC-PTMpgW@`=.@P  䐲TzVB L PỲpD @| ᯲d8PV[/ @ឲS@0 0 @P  tt囨P/0\, @0 L0TЍ,4刨TЍd, ld ' PpxLQ/шQ/@-eM@ M Pp@P%`0S 0 @ 0d8a@@@ 0T geލ ЍK&f\Q0@-@M! QPP! 0iS0pS0tS0S  ش@P Ѝ0LpPt4 ´PP RtPQ/@-M0@@0/ P @ ((  Ѝl`j Q/@-m@Q/@-区@@- 0 @ 0-AM<< <0 0 ݥAߍ$8<@-@, 0@ G-P`M@$忥U? U_ U7 @p`(PP (@P\ 00 0p吥 0 @`Ѝ0`Ѝ @p`(PPN 0  @p`(PP,  y$< 8`ЍL4T `-,Mj $ 0 0  ,Ѝx5 dQ8@- `0 \ X8@ @80P80 $0٦0S88@ lh0@-DM0X( oDpPj@p`P @(0 DЍ @- 媦@@-@Ǥ@ähQ Q@-@ Q 0 Q < @!b! 808 Q < @,!@唤&fQ/@-@M@  (4 z : J Zzj *:JZj({z ;K[k+S@@Ѝ8Q/@-@M@   4(  z z:J Zz j *:JZj({z ;K[k+S@Ѝ`Q/@-(M@ [ V Q @$  (ЍQ/@-(M@ 4 /  *$  @  ¥(ЍQ/@-(M@   ⚵zZZjz 0j zPPzzj'j'zz&j&zjzzgjzz틥(ЍBCCQ/@-0M@   z*Z*Zjzjj %j&@z zjj* j'zz&zzg: zzz zU$  @ 0F0ЍCCB =G-M 0 0 R0Q - p`P嘠嘐@00$@3#860H0  WЍ fp W,<' TPL@-(@(֥  ڦ@Υ8V`G- MQ@P0S @0 @@T ٤Q ЍX ڈ0p@@0` 0`@0V (,嵤 Ѝ 寤 ЍxD  0- M  0 Ѝ 0- M/ n/? Ѝ 0- M+ /? Ѝ -Z> M, Ѝ @-AMM>Pp`(*@P/ .  P/ c ; 7 3 / + '50P.Dh 0A A܍Ѝ85T'+N7'"'''' Qp@-@M Q Ѝp q `l@ @tP0l  Ѝp@踈 Z PU (@0Ѝp@!+Td,sXꅎh0@-DM0X( oDpPa@p`P @(0 DЍ x0@-M@@#d`0`(0  (0  нݍT  @- M@@ hg`0`(0  @(0  ⪽ ݍL p@-`PN@Pp 0 p@- 00@-MM1A 0 BB ;!B B 4t1tB B ,\!\BB %H1HB B 010B p 0B !0S+APB 0@ ] 0@ BT 0BS 㡰(3ލЍ0B` B8 %(F4D$TB`L xQ8@-P Q @ 8@iP P@00H0Z @P8@Ϡ%FQ/@- o@>Q/@-@ BP@/A-M]`a%PßC3c 谀ßp輀p0s 0ß0#03`\``lL NXPg HC ]@T 0R( gP @00 0ӧ T2`@0" I0" D00 "?P l |"008Pw lR D`"00.Pc ( 0 @"'PT 0 (" PI JPEP`  0K ݍ@0! ThqPH0! 0P(0|!p P0X!H LP@ @ @$E 10KP 0 0e0 0u ݍ$O<@4^hL $B<0DPX`F%,-MX !1XX ,p X 0XX p X 0X Xp X|ЍXX`XXHXX0ЍH0 @ ADP40 0 @ P00+0wPC>0 $$C] "4$r |00lP`` 0o$IP0 ݞDv<s0oi@\d@i$@- M@`pP @0ʤT00d;P&{@4  8 Ѝ@`@ 0㬤 ЍtT P /@-d CT P /@-@ThP張L LL0 P@ 445, Q2),`T 8@-@P P8\8@-P@8@Q O@-㌨(( @Ĩᰨ@裨O@-@FP,|$@/ @ OD @-<         P @OG-` p$PI @ၨ tx  `W  LqV  8kU  $在Q$ G-` p$P @N 忨x  t幨W  `>V  L8H0D 娨U  ,d$ LC t "O- M MB0@ 2R`p0@$0  `Ep$0  4 >TPtb0Sl20`rEOP0OS(H0PSD0S0 1Sn! 0   (!0 0OS0 |H10\ H`A`Dq P0OS*H0PSD0S)0! 0 0 O0 (p 0 ⾝0Sʈ d嶝V< ܍ Ѝ$000D, 8B<PdT Bph `Qp@-`屛0S(@P$ l娛0PS@T`T埛0S (@P$ $喛0PS@ppB`QA-`p0S@P0PS 0LLP0@Su!@M@ B 

0Q pv (0| $00Q@40 4( 0@P [p Wڠ00 00 0 PJ>00lDC}Pp !"4$r 0H11 -,Mk  0,Ѝw@-`dpPṕV@& UPP 0@蜥ᨕ p WT p@-PM@ `0@0 UJ0 Ȏ̌\ 0ll 0 Ѝp RЍp@ 48 40Ѝp@'0 @0@ \p \ P -DM _ 0 @oDЍG-PMpU[  2p!@P- P; bȠZ#ګO YO !RPl20S 0y 1`"RvD 00P0 ,2ȚЍP 2  @p 0 `ЍP 1定 p 0 NЍ|at1pd 㛚0S(EOT0PSO H0S\( H1 \聚 1z0  p 0 </0 0x 0ЍG]a" @0 AL@P@8L |0O0  p 00 {p  ( T h  p   O4  0@- MPPP 0(@ 姘 Ѝ0@C@ p@-M`弖庖0SOP   f/DPO0媖0Sx`x外1SNFP @0X00ᙖ1PSO 咖取$Ѝp@T P x \d   P/O-cMMZ?K/@(0, (0 0( ,0.P #叟PD  尠3#3ZȠ7@h`Hp< 0 0 ߠ; l Hz @v_LrP TjX @b O0$ [ "DP4 eB"{DgY(NDPh`Hp0  啠; " H0 PL*P@TTXU\ UO ! 0P0X )10S\ PNh`Hp` p@<00 Y ;  H pL PT X\0`V$EOPPUO H0SD0 S@DP P1 SSX0$ 1"0[XcݍЍ@DD @0Ϙ,4ST \   \   -M M @@8lP00(( $0嬘؍ Ѝ<, Td P /- M  0喘 Ѝ0  A-!MHM@ddd7` (,倘(( ,0Pk ($'H0vPk( '?@PkHDPa H?P3 H:PP H5P  H0Pi H+P H&P H!P H|P HlP !ڍHЍ;P6 !ڍHЍhP@ 0 (&A}()p&0(▞0&(⑞ 0 0 5PJ?54S  0 %(@ h0 (x%thPP= \P HhP@ 0 A}(%p0($O0($J 0 0P 4ɗ~thP@ 0 A}($p0(l$.0(\$) 0 0P 84娗{XhP@ 0 A}(#堝p0(# 0(# 0 0Px 3凗} Pth rhh n \塝V H囝Pp?|  $LC t  ,    lp@-`"&P  @E A"ᱝ ᭝0 `ᦝU  b Pᘝth hh  \N HHp?|  $LC t  ,    lO-M  @2@P孔 xP hP*ᙛP8 uP_p ` ᎛p0"`Wp 0n&`P tᥜ } RP MPdpPU xCP ` ]L!0`Кp HV  0Ѝ` E`iKIDV  0Ѝ  0 p` )0x `p ᚚ p D0 0|S 0V,嘒Ѝ T p, |     G-PM`p(@P Ѝ0P00 |0P @PQ T 0ЍG LC   A-`MPp@P Ѝ0`00 |0嶓(嬚`P (᫚T 0@p TT 0lЍ LC 0 ,  p@-bMFM`P`B@PQ<0C 0@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@ٚPD `8#80`x@X@f8<P!bۍFߍp00( 2N"X0`L"x0`F"0ⴙ"0⯙"@P8cPP X 0`P ,LL2 8@PPP 80KPPX 0X 0@ 180PPX 08$PP0 0:! 偅X 0d8XP L1 0 X04!X q0!?Pژ0 08X0o 厘P 8X0 傘P 8X0 vPE 8X0>꨷DD0  t  $ H T <7F` , d   G-`PM pȠZ3ګOPP UO 1SEPÅ@ ό0S Z 0 0ЍGX"P`HH D0L`(( (0CȠPT DT   n/6O0D @-@4,0T  R,0"(@OL0d4S/@-M@0 ,0,j Ѝ@G$ `T @-``p M@P,@P P U Ѝ,0`u% 0( ЍOh 0@- @ Mn_,@T 0S (00S(0@ 0,@͑T @`40S`4 Rll` h0廑\40S\4 Ѝ0H0\屑@@@ Ѝ0@0 Ѝ0@ЋOt$ $ < d  0@-MMPP傎L@Py ,4 P BQ0S w@0 001@@U?0!0|10!0|1 1MY10\0!{|1dDXD  ᳛P0SEꤣ|X0=P DQ!  屦;P #2 0  ꕧ9dDL PP 4L :'{   D d0uLC h @ e$T     @-0,@, k  @dT  @ //-<4MT P厚 X  ((J  0U4Ѝ T  0@-_M,M;H@0P@ %0P,!(0@ 坐 0P eP 00l (0⎖P(_ݍ,Ѝ0@(8 40{ $  t< 4 0@-"M MP 2@ @0ᔑPPP(L0@M@P"ݍ Ѝ0 ɎH  t @-MM0 A`O A@D@PPy 00> (3 ^L@ @ D0}Px @`0@@# Pg@0@l#P_`\/@Pn ,0 @#@,0 (#@P -P,00 0c1Q{0S 0cPwڰ RR4Q0S,P 0-  e Pd@  00(,2娏 +@܍Ѝ#@܍Ѝ 00 1叏@܍Ѝ@`⺅P!@T P@Z a"PPJ pI-  0  P@  ~@00 (1_ሗ2Q 3Q QP0׍0ҍ@ p̍`ȍP0P|0 Pu @帍 VA  눡``dt |1`华 8P +<1(8( @1  ,1y 堈P 1o喈@` 0(@P@ 0X` 0`P` 0J8|pC(plcLƌYTdH 0@ 0 d  D x  ( ' 4  .!@C-`lPlp%\ @T 0((p ` 狌C@зp ŸO-NMMP\Π uNۍЍ @+@1 0GPA 00 !0ՓPA0X0d+`1ȍ\Xa@P0Sr @ +(1P ^ ^2孍  0;/P TP 00+0圍bNۍЍ 0x0 0名NۍЍ 0P0+|0再00@+`0~ 0H0L0x t C з@     0a-,M*.X,0`Pq00 40PS@0 08} 0@L2 /0P1ڋ>0⋎0,HCDh @  03/P  P0  vv0 | { K. 03/ 8Hb,@( Y( 0` l x H O-MMP@ؠpM@]TP& 00S 0 SL0S l0 S`v 0   0d   Rd` 03/P SۍЍh&fЉ-d0d R 0S R/P /$$ 0P//h  ܟ \0\ P 0 S R/P  / 0P0h  ܟ \0\ P 0S R4/P /  0Q0/h   ܟ \0\ P 0S R/P / 0Q0/h  ܟ C-M0p倁P`@S1 \J ^10101@0@1010X ^ @  /  RS" L@0 !ЍS @0^ {0d  ЍLDЍ 0h  ܟ   42O- MP~| PMP Q!pe rg!q`p\JX& : u \(=`9S46cN@T`d m 4& Rd@04!0e2c19S=vM@☰`d P - Rd@0Pe0ReQh:Sl1څ]MG0P0@W`l1`S PAOT0ˈ0(,20 Ѝ 0 垈 Ѝ( ܟ  8  @-M@` 0 0rQP88| X O-M]`@pM@=T` PU 9S=)J -B2R PDDP 00  [ ߍ A 8@-'`0` PӐJDD @V18 Ɛ $儐98LC d p8@-P D@ᰐ<< 7# Pf8p | @ O-p-lᓐ-\叐, L׏=SvM@`Ώ `P  ᳐=d@S  (l1S%㰏l1SڅmM0`0@p㥏 tp `Pۏ `׏Ï ቐl1AOS ẏ (ᴏ   d A-l1S@yl1Spڅ]M0P0@` ᨏl1`S PAOᎏC-`p$PX @ᐏ | p, d X倏 L|UD  <v44 r^`1    @    8@-P$ @\H8`1 A-j@&,N-忏-廏 |巏=Sp vM@P 5=PSd@ a , dTT@-aLL LAH\<̈Pr(@Qt  d @   0@-M MpP lK@ T804d @0( (ۍ Ѝ0  ` l C-M MDqDa@  ] Q@ @@d0὇v  F @@0᪇ | 3 @@0ᗇ \i ք @@ 0ᄇۍ Ѝ ` x  X  0@-M MtP0 hK@ T峄04d @0(^ 壄ۍ Ѝ0  ` l 0@-M M@D#\ @ 0P[P P0d30\\ X0ۍ Ѝ0^ @08@0 -      -M M 0D4ˍ 0ۍ Ѝ| -M M 0D4ˍ 0ۍ Ѝ -M M0 Diˍ 0ʆۍ Ѝ\ 0A-M00\ Pp|A@` V`    0S >(0W *܍܍8 0@-M MPR  POR,0 pP P0@}088 408܍ Ѝ0 広܍ Ѝ0\     0@-M MPR  POR,0 peP P0@I088 40܍ Ѝ0 冃܍ Ѝ0     p@-Mpp(b0R@ 0 0 `P@3<0@88 ݄ (E$`ߍpTV   T T<'*@-̀M}`l=(@], p` P400@,, 㰄 ߍ  T  T<p@-M@04(b,R 0 0 `P0,0@(( ㌄ ߍp T  T<8@-Pㅌ\\ @ὌVL ᣌ 44 (Մᒌ8@\ 0 l <'p@-@`P*/P   p@e 0p@Ђ@ x 0@-M@P  Ѝ0L, z0@-M@P $+S} Ѝ0 0@-M@P m Ѝ0= p@-P`@P  p@p@-P`@P {p@p@-`P@P ~p@p@-P`@P  p@@-@ Mp,PU}P`0d V , {R O0P ЍE B0 ЍP@-`@pPUd@ ~PP/:O-vMm@ MPp  t  ` [ P V @ Q 0] Ѝ'   O-Pp蠟萟@`M@] TP`+ =$0⬰0S p0 Sl0S  PGl0Q~ p PAT  ᫋l[]fIb- &O- M`Q`q`` @`M@]TP`F -$  R p  Rl R N PܠcI p R 很0S`P@  ߉0| @  Q0 \ L0PSlpW 88 80 ЍO1 ЍfIb- &,   P G-BM}@QW`P8 V W1HPW  h   .P$BߍD18!W=S ʾ0C S10 1U   = v}‭p P y P yXz  0 P E 0 P jy}I'd@ ZZZ  P@-`@pPUd@ gxPP  axP/O- M.`p@PM@TP, =$0 R p 0Rl 0R0P0P0  dP000 P0S40e#u= @@  Ѝhfb-&O- M\XQTqT@`M@] TP`B =$00S p 0Rl 0R0P0P0  jdP000 P0S0 46046Scn@`P 0d 46PSd@@@ J Ѝhfb-&P@-`@pPUd@ wPP ` PwP 0\0/O-M` 0+3JPUCPMKU@A s=D<0S p 0Rl 0R0PPp  0pdPS$0 S" @\(000 +20 0@000<#C@<DL H0 0(;@0 (0 h~.Q9 =0(P- _ h [0KMV0$R0 0S460cN@ `pd @ =46 Sd@0  !000@011 @w/0SvM@ p 0pSd @`Md 0X+0{0 000e09Ѝ$0 S$M` C  h&f F ` $ ;l!R pAO01+($@P0( 0P!1@t#@ 0  00@ 0t\Ѝ 2  p=S0 QQ} l0 LSl s0$0 04rI   nP     O-M@`P0rR렢}KXp+ s=G<0S p0 Sl0S P"}H" x P PŸ28, u͌0 @rg+1S$f 1娀0!0R r<$H@<DL H0 (@ p ( d0 hs06Ph0 pP@4 :v‭  0$     l(` R O L 0P`]D0+s0@00 0h@x0@(nЍ言T!0hB  &f    F  C ,   O-M@`P0r뤢}KXp+ s=G<0S p0 Sl0S T"L"  =P 8PŸ28, u͌0 @qhg1S$g 1娀0!0 q<$@<DL H0 (|GpH( h0 hs0r h0 pP@4 :v‭  0_   Z  Ul(`   0P`]D0+r0@00 0h@x0@>(Ѝ言T!0(hJ  &f P  d F  C t   O-M0P+LLL3rD@C `MKZ@I sD<\ p 0Rl 0R0PP p P dpPR$`0 S2吲 0 `L(@ p 0DD+T2tr p 0r 2Ri @Z}Uo 484oxx<S`0pN @0}08p 0 D0 xxc ;c88cP5ch2c;✻A  ☻8C╻ P⑻Eh⍻F  bЍ  ' ' ' ' 9 ,< @-4@0d\ 0^ 2 L0-0S R \\ R/A-@`{p 0@bT0PbTf /A40/A-`@vP Y`p 0@b T0PbTfG-@M8&Pᄻ0`S SV F/o" SQ SQ S  R )S0t40pSM S Ѝt4 0p43 # $#RS00V0X0S< `V Q  T 0 00lp4Y I B `0W 0 `44W0ǔ4Ŝ4X 04Ѝ t4̓ p  t0 S R P^ 4'j4XW YZ0t4 040#3XW*BYZ' 0S S_ 0t4 05 0%0 45P`3L'j0]0t404303050<"?oXW2Z Z)Yr "X00S Z!Y 0t4 0z4#:0z2G΅'zjzkj0% XW!YZ; #34 p$'82yj0,Ÿ 0t4'2@mj 0t4043030500t4 043030500t404303050 0t4 0#44,'L1 :j0 0t4 0:z4#:0G΅z'0z0t4  0'j 4:*ͅzz0 0xxzz'z j0  0 5 t$`0$$'i0B` : & `< < = h= < < < 8< X0S S  S  0S/ #/ 0 A-M@0S p`Pt0S 0S0SVHH'D0 pi 0SЍЍ : C |= O-P^M M@`Pd 3#SÔ R \ Q 0 tt'p1i^ލ Ѝ^~p0 @0'01oi05'#Q?400< h8 4 Z0 e,F  .` ##3d^ @T"`G^ލ Ѝ/  4g,: = d  ' ' ' ' = 0@:s/g <: @> C-`@Mp P 0  2Ö \0PP:h 0㓹P,pЍjgiЍL: T> \> O- p> x> O-jMBMp   0P@`崱 0崰(4 0\tP7 0[P0 0B0*0|J x 2t 3R:0R0"0I6s @(0!7=k ( 0ʸPS姷6@6@PP0jލЍ`h!\_`\!p\ZU`4 TU: P0V0@@0V !7k @ 0㙸P,vjލЍP0( 7%Lk  0ジP|_6s  㮶pD\Qf  㤶p8GfL,Cf: : > ' ( > > > > > G-@M` P 0 pN y` 0 p`9Px  00Pw  0'PЍ00fЍ e e ; $; > > > C-@$MP 0paW`$Ѝ`0 P 030yP0T(P 7k  0P$彶$Ѝe: h> p> x> O-p@,MPPba  0尡 `N `Y P`PXT 7㰠&j 0㩷P,ЍYe,Ѝ9 > p> x> @-P@$M`  0p0  0F> `Pd `P7Pj 0rP0O$Ѝ IeH$Ѝl; ? h> x> @- @Mp0`Pd `7`P xj 0GP0$Ѝ eЍ; ? h> x> A-`@ 0 XPP`^ 0S(1pA@h8@-@c<@2^0TD S( 0(@cT8@ c? b "p(8'T0@Fe4' A; \? p? #p? ? @ ? ? ? ? ? ,@ @-c @޴; @@ l@ @-c @e; @ 3@-&v@cTPcp`呴T d9S dy41lbvPP \|c&#<sc@ ; @ t@ @ @ @-@p z00@Wc; @ O- M$M,0cpPG>$7h네儔@$`@W4>%PP7ژ4S% S S ĝ 0Q( `0 r 40C($ SVLUW0WDWTWdWW\XXLU(XlV(@W ۍ$Ѝ ۍ$ЍXll#]a^`L# ]. #D^4#]. v#%b3Q#^ ].0 5b#%^R  %^^%^% BRuxXLULULULULULULUxXLULULULULULULULULULULULULULULULULULUxXLUxX Y0YJ> 0C^ %5bHK^ 05^> dJ> 0C^ $1^   p 5 dT!吳 Lōw K"$4  '1c0 ^ a]^  [%ĝ0d㐲    0ōM]. "- 0  d05?;; & @ } } P5 LA 4 A d$( ' ( L) 0A X) ) @ |) 1 )  A P@-PPM MrQ@ 0` ` aT*T p1=}0 0C45kPW UTD\Z[\[<]4\4\]YH:SG)#i<0)0Ii0t)t9S S2 SS  S RS S& ;%d)S; >PiS`7>(IS0 D  9%Ra_. '"ݍ ЍXH:S4^D^^_@`]8 H*Ht9SYU |S@~t@{ʔ*0 TH(΄jaHH:S0(0h'h'_>0t)N<0,? / 0Ja%RGDaG9S!:|ǟS :`@ @>HJ2ap$.ah4'$0>H:> <7 a&啲.&F>S8 SHz0&H:ap6 .lF>S0C>fʨ&xT6P H*20>[ad,vPD Tl6 ??C`-@Q,ױ 0D <D  0w>0D *f0ٲP`忱@T.P 0xaVڲ>0_P@rh:S_LyXET``}V@(啱TV $5BR!P Q0S D  D )tdPtD>S~ >`d0KS>@6pS~adM-4ğ q.B1- : BD  }PTZH'D4@Ƅa>*0S>3C .E`0H:D  0LH:6`8#^H#0H:ñ# ?B8c0c*:<10:S@!@2\"Hʃ`H `J@`@v0H:d9孰_.D  x}d0D>_D Tw+R- D 8 42<0C "0C0 05m D"H:p _:i0TH:_2=S/ <2D  00Z'<S$ D h 2_>0!_. F_K_0!5!_5d   @@.ō|._>5d   @.L@ō.T8y_~5d   @. @ō. g_n< 0LX"  f d," ,,B L\hA A A A A " TC TB pB <" A< '@ B B #@$< C @C B  LA E.€QA B C B 4 4' ( a#,$-}`PP!|SP t 0[YP0PIP@C}T0qT P}Uߍ}Ϡ0 40CcP T񟗽{$x<{|zz{{zzzz`OX00,PQPTPPXPP\PK Q* 0AS ?ltj0|zS VH 7P L3S=SVVQ-0RT1>wP=S >0 0 PLC=XS>0 0  0>BBCL3AS>S .dRzd䮁  T1dZ␳ 0@匞KT1P⌮NH 0 5Pb VV3LS0UT1凡5>L-S><-S>,-S?S M0S1 MSv 2S5U  0 5PU/ 0 ݍ,ЍNB>00 C>LƨT1d U⒓,. 00C/T1PNx 2Sq >00 匮C媨T1d ⒓). 0&PT1L]X>00 >L周T1d Z⒳,. 0h PT1NLC5Ha-p0+ T!dZ␲ @T@%匞LP>N(T1dZ.␳  A0@ P⌞NT1*T1dZ.␳  A0@ \P⌞NT1T1dZ잒吳 . 0 @匮KP⌞NT10H<0vOT1d Z⒳,0T1$%PP00L0$0WUW$< T0BP,AU00  00.0㌞ArPClPP03P0K0 00002P0K0 0+/=+;Y3`X< PaH@!a`H2S`L3SP4ST5SX6S\7S`8S"`` .a` Y00(2X`S+/=+;+/=+; 0W;6P8d3=1_6P1761 0 0p  0B6P6$1 0 0p  0 xV I6P 91 0 0p  006P80 0 0p  0 x`u s`mTC 0 C `F ( 4 " / K xL 4^dK @K K L L PTK `P" } 0L 4 4 4 4 ( ( ' hL R G L XL L 1 1 x 8# P# L } 4 3 3 << .`%HH )`TT $`Td ` /t`v5P:0 0 0p  0lI5MZK5.o[0V㪢T1 0F(VS( F/o":0FVS70T00!T1D 01P 00  0: @- R PZ00S t@<S0CS< P@P@P  6,,U /U 4 x`F M S .|dRd0> |⦦|͔ l*t:@ PHm@`@88(40Wyߍ0$5.^M M |F C M M pp@-FM |j]5@l*t: `P0B(q`@ (0VFߍp\N F C M dp@-M]|j@l*t: @ `0!(P`@ (0VލpN F C M ?`@-L@L<S0CSL< H<( S0CH<2UD)`xF M XO @-4@D<S(("U U 20L,H<xF L pO C-MMFS-; P80TX4 (PU㮥0ST0S 20L<TInP`E1 D`Pl(|5Pp,pWV44 80]PE0D<4@%(0\P4(%0\P4% 0\P$,04\$P4,p\pP4"]P@TT X0]PT$$0\P,0 4hh4 V 00 TP$t0č\Pڔ4dc (t č 00T$t0[Pڔ4dc t č 00T#t0[Pڔ4dc t čw 00T#t0[Pڔ4dc \t če 00T0#t0[Pڔ4dc t čS 00T"t0[Pڔ4dc t čAT"00\Pڔ4dc 0 čHT|"00\Pڔ4dc X0 č8T@"00[Pڔ4dc 0 č( 00T!t0l[Pڔ4dc t č 00T!t0Z[Pڔ4dc t č 00Tt!t0H[Pڔ4dc Pt č 00T0!t06[Pڔ4dc t č4S 0H P(,  `@ T  4\/<4GZPP |0UF O @ xO t'  O  C O 4 3 P" 2 " ' ( ( 4 4 4 4 A-vxAJ4DAl~D A`z5D ATvD AHDA<D A02DA$ aDA^F/廤 PEq\ d0q^6SF,0]@,01 F](S 0B  0m| |0hp p0Ab H O O O P0 5 5 Q x(5 bF ( P P (P I4P DP \P fhP ltP hP fA-M[!KQaQ ^P 0 S0A 1*KT/Hd00 h00\P 0SpW P 9d2S 2S!l3S 0\!@h\!d\!`\!\\H\00*0T^\ I\y/E\ A\ =\)\0*40hh0S{^\d2S; R  `0< d L/ D @, 5 ` t(R @-P Mp`[ @ \ \ \ x\ l[أd$m\[0*0DD0DS6^ Ѝ@[0R Qp $4p@J 0 p@J\ TT *&f \ p@- 0`P||Jx0 FRll0<2\ @T< ,mΌ !pp p@J\ dT *&f \ O-M@d1p\,X LT1 DR? GRCZ ,0 iR L0 cR,L |E@, PBݍBݍTh d0K8PP L0 K (40KT t, l|\ \ \ 8@-P @oP᳙8hO-sM 9,MS  0@\ P`@P ٙ` 9S Q0P 0@ѥ 0@ $ R4  DI 9 S Q-5 ;(, OP(( ,0 RP("0@QP PP| (0@l"Q0P$0(P"ZPPi(@"UPPd(vQ0P0^ڒ_p`H@@ 0 00(Q000 0(`Q[ @0p@dR0pCpp` RX @0P}RQR P@RtRHR$ PR$ R RdRD  @1: )  OR 9 Sh 0 9sݍ,Ѝ!R`x HU 9 SS 0Pl `pPP p 9S 0 $ 9HT ] ,  ld\ <] O-yMM=0 CP ,5@,0$@I,, 00CQPT,%$0GPPU$PX Zp-pRr: $ 0 ,X%0OP p KMᑘP00 0 0:<0,%0OPL(@zP(0,$ PP( 0S 2ğ0 p2,$@pXO@P pڀ00,l$0OP k(`QP;0,$$0lOP R](P> 0P0 0,#)OP, h 00 0,#OP, 00 0,#OP, ,d#OP, ,D#NPXY>00C$#09, P0P0J00`K=L@lp 0 0 0,JP00 0  0,CP`Pe 05S$ ZU!0c>X ̗dPdP0 es>0P, 2嘁H0S0S> 0S $y܍Ѝ,!N@PA 0S L!1G  02 !0 2D@2 0 2D@' 0  0$0l00HPP 0zH0 0sH tx0lHT t,    Xl 8! ! d&b \ x] |\ T] \]  \ \ C- M`@pP6 0S R Ѝ0,07HVkK `P 9S\@ P 0 S@ 1 9S9 P0%040@,,0H Ѝ@$, 0HT 0] b   ] G-`MK @Ӗ0pPA͖PP<:(Z PÖ@PX 0S @ 0PMU @0nS0oS0wS0S <(0d P,X1G U4XY 4!j,咖P XЍc(ЍG8Aj]0kM$P$@0,P@0G0 0"P@ 0 | 4 <(0d Pp0,G 40SP @ 0PMU @b  ! T ] 0 ] ] O-NMMϠP@p,l<`d $,(`H@SG(( ,0NP(,,MpP l \0,(@@M@ 0 (+:M 0 EN܍Ѝ(+L@P00+0(%M+(L(+L(+L`P(t+$0MP8$Y@Pc $0(0D+0xMPV$ ZK=p +( 0L}}(*L0P0u< 0*0(YM 0*(TM @  0 (*L 寕Pp 嚕Pm =S =S 0=0--0 D 0@E P[$*(L(MP v}H0@p0 @=dp S (M 00)0 (L000) 0 (L=)S=0CS  P PP9wFN܍Ѝ NP<p0 X  <(0-((_L(0(L0(0(pL0((LLP ` Ps-0-=(l( LPڀ ;(0 L((3L+R=(0 0((+L ( (KP( 5 ((KP( ('KP( ('KP( ( 'KP+(L0x<P$p ZxI0 0@!R+ 1 0 1(0 bK`(L0PppW P@ (}L0(%@ (K0( %KTP 0l[l@0SD5H0S14$05> 0p C& 0 X C%Pᣕk Xl2Dl( !mJPcn 04 ( K(`0 0(K` 0  =B-<1Rp@1 c`0}d $(46e1 0 :6X)zp0 02ᢔ ޓ<4 0B= 0=BtT  LC @p | `Z `! (^ 0^ D X^ ,   T^  b  |^ d  B  p l 8! ! IX|\ >|_ ^ & ^ t_  \ $^ 8^ \ _ 8 4 } `^ 8_ 8@-@PPŒP  <<yBSO@P o8_ U _ P8@-@PhᨒP 8L塒P <<UB/O@P _ɒK_ `! U _ PA-OMXMxcNύP,dd3pO@C 0KP@,80 #8@I0# JP =9B =C2S2@X   BO܍XЍ"2 D8 00@P 008 xA `"0IL"2IPPUڀ ;(0 ,"YI+R=(0 "QI"IP [!IP ! IP !IP !HPPJPcnp 0  RJ(`0 0  JJ`0  0O܍XЍP 0BO܍XЍ<(08~ sA}` 0 D8 00e@Prt p0BW4U t  &f_ |\ _  l 8! ! d_  \ p@-`(@PőPyphA-fMP,$2$$B 2 ERc2"%#<(@T) .㗒X\ R `p0S R l\ 0l\ 0Sd^   RfߍR l0S0l\0Sd^0S`$0Sp,0IBW`Q 00 t@fߍ0S 00fߍp0S$4,,0"BXp` DU 0*&f` $` ! \ O-M0`0p,ll2hˇ @B <<0P  RP!S0Sx0@0  x0Xd`_ 0 ,H1A1-R0 岐P c4 S0P0S0 P8  0T0 @0k1P= U < P@Y=Sc4 $0P0S0 㴐0 00@ꨐ0 0T U <`@@Tߍ 0B@,B)4XU ] 0H` TIh` Xp` O-MAQq就`M@]TP`3 0S 0S h0S p0 Sl Q QQ>$ @ @  dPT 0 @R 0?Ѝ @0 Q Y0 0P6& ЍOT`i@ DT0? (,Z@ @LC hU l &f` 0S/~8@-@(P0S s8@螏h@-p(@`P܏ |@菏h0@-4M@P6T T 4Ѝ00T P;?ᶏ4Ѝ0@0 @$$= 4Ѝ0` xU ` p@-P,@`ᤏ PWphP/@-@P唏L0  KR0 =T$0$$>@$&fp@-@\P`vP c 4导P  @p@hP/<0  KR0 =Q0 //$&f<0<0 S R 0S// @@-p3PpKWP" =Q @` g#p@p1? \0 R 0\ 0S$0g&ƎP&f@ 0@-M@Mu>S\tn>K,``@`0 \\ P* L L @ L 4 LۍЍ0U a $a @0 PH/D;'LP?0 0g> ܍Ѝ b U Tta <a p@-PPM' `\F `@Fi FyFPҍUJP0+008>aFЍpt0`.0` `@y9JP00+$0>EFЍp?X^ T^ U db LC PO-UMbM0r@M@T PK U ،P tt}<U>1DM@TAH0DAꛍ42m⛽X`z 0S 2p Rl0SQ>p`P` P 堌 1 P8 S10$!R (圢"P PP $!(!0SlYlpD! `pP (1( j  4U 00,0=(Sڃ1$1S (P X 0S  P $QP$!S ^lYlp(UލЍfh@b V b @Љ-I&$1  LC b \ b O-TM``;\sXCҌ [K[ x @PU PEU@P P,3+=L0S 0CSL0& 0,2=P0SS [D0S 0CSD0 0,2 =X9|2⍌PdYPP[z 82,2, $$2,<$308 ,(40$v. 0 &u[X 0D0ۋ嫪呋|10sPt̋tQ]PU Q 0S l`P  ]0P*;UecE; R곌 `Pa 0,0l0<{DTmqX00sUPlDV X@$V b b c Pc @ @LC c $c @4c h@^ pb L@--AM$0  埌  HAߍPHp 0 ToA0 A0 ApK> \A0p 0TAO>p0p LAQ>p 0T DA< Ѝ00 A( d |* d d d  d d d d C-fM,0 M 0C@$ S$X 0(P0"c0$($ (%fލ Ѝ4S(P Gn `1$0d(P S $嘶4S$0dS lK.$卶4S$0dM.S  <$偶(PE.0 $0x(PE.0 $0oPd0!d ?#c{(PE.0 $0[dP$nG~ p0Kn$0:181MO31\G(P 0?d<$R 7Q> K2 n. fPn0(:0$0e4S(P Gn `1$0d(P S l$4S$0dS d$$<5SF$0dQ.S 4$<0?P 0S T @ @   0H)0T X0tF6 0 01P 1S 1S 1S( (1|! 0Z\`!!d1Xs!T!0WPX%T5\5lP~ 01Sw |1Sp S5 S S S SL6!1 pp(tć3S \-gTH(庇g,3Sg((#宇gԆt6S 6& ;0R= 0PR Z@'PX05g'∇ ;0g.R=t 0P R n|1SkH5Ad 0S(@ x ``  5V|!5{x(67J82SG3-P .-P )-PR |1Sk ;Q6!1 x0&t43S ]-g&*gP$3Sg$ #gD,3Sg(#g8P3S 7-g%g*t3S ڜ8-C gg3S d-g\P%g t6S|1Sx$5!1  $tφ3S ڈ,gt$ņgP3S ژ,g$巆g݅t3Sgl\$嫆gхt6S|1gWrP>=0Ct$$喲@Q < s,$,2P84@2(<"4 4!1<#x ;0R=8 0PR 2|1l,J,PI XE,P/ |1L4N!1< "R ;0R=  0kPR  !1 P"= ;0R= L 0VPR !1 !( ;0R=  0APR !1D ! ;0R=  0,PR 5ᄅ ;0R=X 0POR K!1 ! ;0R=  0PR \t4Z ;0R= 0PR  S.f Hf lC  / d  f h f C |g $d g EX* $! i @i di \ g 0g g g g `g } } i Pi ti C i (i i " Hh hh h h @h h g h -)M Mll yddd 3  B?LPB)܍ Ѝ( 3)܍ Ѝj 0d Xj H\ `g p@-0H@`Pᐄ⍄ ڃ0 p@0?lC 80P  R0 1#//L0@S 0#/@-(M⿄_@| 0 bp!<d d0> X0T⨄H0 0 L ( G0(ЍC hj |EG-mMM:x"0*>C0 P?@P  0<P 4"a:P ᏃmۍЍ 3 +W> ! 0}:!H:P!0:PڼA΍`1!4܂,8a屄4!A41S  X2\<t|! = d!= XO/<N<1SboG< (p~< z<f< ,=1d`S ]< < W<Y  P0  < \`< <<@< ,t2@0<wxT^ j k X^ k H$k H@00 !09P5 y9P/ (2 o9P# :PP`Tp  00P0:00 0P090 P P0`Sdp00@H, j k   lk k @-M@X ` 0`⪃` 㸂phލ\X0D ♃HH ? < 0@⏃ @0 00Pg wep0ꊠ>1 L0 1,* 0pp0Y2Q`k  L0< d xN CR [ 4 0l  l 00C 0 ;4@Pg7Pe 00*1$2 (0!!8PR0l!8PK(`PF ~pD00>'<0 @D0奭!h席!7P08P+ڃ>0CP 800 0P`70 PS8P   ⎭0t 48p@ UލЍ*801 l R l 8R C`1 X" [ ' 4 l @-(Mh@h9\ d0g; 0Hߴ⌁̀)  0-(ЍLxN l CQ0 Sp//L@-0@ QP0 K+:H,An l n L@-0@ PP0 1+݀ H,An l n  /n l P 吁十Ho n  0S/O-@0M M ? Bz`pP 0 Ă q  0 0$UPBހB/@0@x/܍ Ѝ` GV`BkB€0B/0o } } 3 o p  n l o 0 R/O-fM టࠟM@?`p PW0uP 4  0 4  ] 0p4  T0 pᇺWpfލЍ} } 3 o 4 3 O-eM` M0S eލ Ѝ0pPĠĐ?`@ 0  $  $  0 @ L@ T 4Ts0  $  } } 4 O-eM` M0S eލ Ѝ0夠夐p@?`P 0 5 $s0l   $  ӫ0 P PUeލ Ѝ} } 4 O-fMpM0S fލЍ 0P`?p$@ 4s0 T T V @`  啫 0 ͹ 0$\\  P @@} 0 @  尹P" } } 4 O-eMp M0S eލ Ѝ0R?p 0`P@@T  044 (( H0 ္4 } O-fMpM0S fލЍ0R?p 0ĠĐ@`P0005 s0 $   $  \ &0 P BP U`fލЍ} } 4 " O-fMpM0S fލЍ0R?p 0ڠ堠`@P 5$s0 l  $  Ъ0 P PUfލЍ} } 4 O-fMpM0S fލЍ0R?p 0ڠ堠`@P 5$s0 l  $  0 P ȸPUfލЍ} } 4 O-eMp M0S eލ Ѝ0R?p 0`@PPU  5$s0  $ ll V0 P 劸,0 G0   }4 } }  0S/O-@0M MB ? ~aQ $  ~X.} [ 0 4q$00[ 0 $ [&~X @L0@@,܍ Ѝ~00o } } p p  n l  0S/G-@0MM ? Bv~p`ԐP 0q $00ZB}B/@x0@l,܍ЍT L~XBp}B}0B/0o } } p  n l p  0S/A-pMMBo 0? $~WP㐀@E}TP  h~U@ }00}< @00@$7,܍Ѝo p p  n l @-RM@@  0@PP!,zzJ jzzjgz7zv'zzgz dPdЍBm 4p *j zzjgz7zzFz RP//B 0S/C-P0M M ? B}㸐@`p 044@T`B#}B/@t0@h+܍ ЍP 0}XB|B}0B/0o p  n l Dp  0S/O-@0`M MB ? f}VP#|U  5 Ăs0  P  Č xx0 0D}X |X000|D @80@,f+܍ Ѝo \p } } p  n l <0 RR R 2 // Q h0SP 0S0 , 0 dR  P0//0Q O-eMp M0S eލ ЍR?p @,,`P 0\5; s0.2  .    | %Q !j ! '" t# 0 P -P U`eލ Ѝ} } 4 4 ' ( ( 4 4 4 @-`0 RP R p2'd^"P@PPdU R"@P1 p Q p  0S/O-0@SMM ?  M|[V0$0P`p/ 0$%   $P!P10(0"# 0!," (  , @ !|$0S0$0! C{P U`p 5 s0R0U  4  00  |  { |{\000 v{H @<0@0*SލЍo } } p p p  n l  0S/G-@0QMP ? `{Vp0ؠ  W 0`VpP  0  0  {Yz${P.@D0@8)Qލ{0.0o p p  n l  0S/0@-@0QMM ? v{Pxt  0 ` f{z>Hz<.00,)QލЍ0o } } ,q  n l  0S/O-P0@M MB ?  9{U"܀p `[ +0r 00  {Z @z[ zX @L0@@?)܍ Ѝ z$000o } } p  n l p  0S/O-P0@M MB ?  zU"܀p `[ +0r 00  zZ y[ @zX @L0@@(܍ Ѝ 0z$000o } } p  n l p  0S/O-@0 M M?P  pzl`0 DzY'p4PP U  5$s0  $  izB ezWp&yPBy Uy P@/0P@y/p0Pd@|(\{y LDv( ܍ Ѝy배?ⰰy배o p lq q  n l ?Q/x20S6 A-遀@\rB 0`P @0 0S~ Su Sl (Sc SY SO SE S; S1 S' S S S S A"( r0 020 020 '020 020 020 020 020 0201020020020Y0{ H Am q -EM! 0   yyEߍq -CM 0 my 'Cߍq m 4r C-`Mpx  y @P  PY 0^|\ PU*\wЍLL 0q' wU$ "exx 0m @r \r n  p@-MP`0)@ L0\s00*@0dd ;`P@,Tw 4P4Ѝp@xw  4'Ѝp@pw C xr r 9r! 0r 0P @R00 QU rp r `r0 6H A@n u /Q/@- @r04@ p@-(@TAPPA p@0!Q u Ln Q/0@- M@ q Pq@t@ 0 |! Ѝ0Xn u Q/@-M q@> 0 h!Ѝu dn 7C-M0p,L 00}P@020S0S ` y 00d@@T0PЍC\ u H A(v Q@- Hpp0@ZP 0``$!0 oR  fR  fR0SZHH} } pn dv Q@- +@ '@v |v /@-q q꠆|n 0' 0(0S 0S // 0(00S/  0(0S 0S//  0(0S 0S//  0(0S 0S// 0(00S/  0(0S 0S//  0(0S 0S// 0(00S/ 0(00S/  0(P/ 8@-@Y@PGHH T80O0A0E,0JLJG, L0 (q H?0ZP0 g 150P%S@SPP ( 0R 00V 8U00TP0 `|J 8LlE 8`A 88 H: 8 85 8n v v } } dv Lw 0w v |w v w /@-@@T CP@zpTw C-p@p`Pp0S  0BRs0 S0 T`0@p*@ R O-MS`X00SX0Z2Qy 2T.@PЍ@d 9P;@"%!0S f[` 0 S R UPpPXPU [5 2 +! !;P$P 1Up@WU@pX XpP| p0\àpQA0S0 R 1Q  J0 t pP)0@ $00Sڠp 0|C 0 000S0p  Q0P 0<,a Q C n w w w H Au Hu hu 8@-T_P7pBH*:@APCPC(Q+@\@p ???>>> (?%?"????(0@0S 0tt  0dhP1T!T>P>8<op8w w w H,A H AQ n (x Xx x |4O-MM^`@0\0:%0TğhHt ,pxIPt 0nP 3) 0000+P ލЍ#%`PC@ x0 #%p#%P60S`0 0  %0Sd`ʈ nP000 nP0000nP0000nP0"0e0 0n`P? |"v%P &0P0K.P`Pp  0 & 0 &`P)2}WdP0PC)1čm0E Cqh $p00p!d[%P#4!$%PJ L1J$  p T0D%`PT0S V0iE L:d0 ᓐ nd0Tⓐ $n4d P 0$0 404K>0   Bz S 0y z z C & f  dl# % '"&&002) &&x"@&<0 #0 X'&0 0HT2)t 8&t&("@&0"n0 &<0 #0 &&0t01)N s&N&x!@&00 &<0 m#0  &_&001)& K&c&&!^&0 .80 0&<0 C#0 x& 5&0,0ht0) Xd !&4Py  P 0< d ) 84 { \{ f 0z z Oz { ${ <T{ l> z dz @-MMaQ!0: ,(P 0 S0A 1)/md00 ||1%P P# P%TT!p%Q3Q'%00  1) %m P l%Qp %%00)00 <"0 &0 <"|0 &0 <"T0 %P 0< \y  d , l> z l{ O0z f d@-pP@`Pre=P R P U@ 05 1A\2A@-M0@ sm l܍|{ C-` Mq#l @eM@T @PP@:P 0k Ѝ @@ T  0hpe-Sl Pwl@sle= 000dk ЍP1At \Dhy { \{ 0PQ/Bp@-0aS 0PQ$ p@'0lS0lS`Vt@tPeM@T <0S LOeM@ T` ((p@LB1A]D{ |y { Pp@-`P@PP U eM@P 05%pp/1A\P1A$ P0P//BS $0P /0 Q/B{ S $0P /0 Q /BS $0P /0 Q/BS $0P /0 Q/BS $0P /0 Q/BS (@- @ (P @(8@-@0P0k00k00088@-@0P1k01~k0008\-0 2l | @-p`@P P PU ,0S@RQ0@-p@0@P,@R ,0cKk @Fk@H-L,AP,A.AO-Mp@#а`# #  #0S@㐐吀P |P@@0kg$0S# @# #k #ЍL,A| * | .AP,A(| | O-`p0@(,j# P$ $ $#Z# @mp #fX #HH # <#k#jO^#<| @| D| | L| * | T| A-Pp`,#@?T `#8< Y#,, U#A#jA4#| L| * # O-MM M0@`P 0^"PHڈ( @P4@p0p|(0 P*d( @P$0pH(0 PpJ?(( PpZ? ( P pP *XIT =U 00J Z?\Mݍ Ѝ@x 7X0p' 0\' (0H' 004' 80 ' @0 '} H0&w P0&q X0&k &0@e `0&_ h0&Y p0&S x0l&M  \ P( D0 88 ,@  H P X ` ph `p Px @%0崀  h%崀5ş崀 `l%0Cd2XXp2 %|% hh `hj?000$4_ @$  H0@L 1S @01S 2S 3S 4S 5S ,R L@$0 X 0< 1R0 P02S 3St 5Sb ,R |#  0< 1R0J 01SC (01S< 001S5 801S ,R p\d#T t`L01S #J$#F'$L"9"2 $Pnjfb^[XURxxNttKppHP0LLCPP@P0uH;n@@7<<488144.00+J'$!@0:@0- @0#||@0\| y f  d  h| x| | \# | | | | | | D# | | | | | } } } h} (} <} P} `} t} } } } } Bj  " L,AH-} } 8# } } } } } 4 x~ ~ P#  x h t   ~ \  L 8 @ . ,   ~ ~ ~ C ~ <& ~ ~ ~ ~ (~ ,~ 8~ <~ H~ L~ X~ \~ h~ l~ } ~ ~ ~ O-0T☐؀GWo@     ]M#̓+- 0P@   SP@ 3́5-7=!1G-MbM R |R0@T 0\PX @LH"h!P0xYep0P9 Te`.>P00P e @T$  b.;U> 0  0P00 4@PP0 P0 0@ET܍ЍP   >⭢ 0`܍Ѝ< 80( y x f   Lz Dz   p@-(MAQ+mj!d0 0Def 0 ee'e`f 0e0 ʇ0x Ňl d0 0Xeef 8 0ie(ЍpP B, p`gP& z JTlO-`MdAqP"]:SX\H v ́R`dhl  L0  H`x@TPO D0S H0S 0 He@0ST@jX [ Ne1d0XH Q hdl  L0  pt 0H\Q   L0 P  d4Ѝ \D@tDk 0< L, X p $ ́ @-pDP`@dP @T D@X O-P@@2T* DxQbdx qe( (0B#a0(Q0d 1 t p DH@deP `dXQL@ \DQt  C- MH@(p`Pc0 Pc Ѝ  0 /p@-BT`0`M1PD\ L  PH0 `Tp*t0}`<X*l0wU`4*L0nLꨁ  \Dp@tD  C $ t ܃ L `<0@-1MD@T LH0 4/Ѝ\D-,M/bb 0a,Ѝܚ@-@d `@ @k 0@- MFa@pa d_=aPP T0dS0400 @@T@   -P ,M0bab  0a,ЍD!t0Q/ 0刕!dԅ 0Q/ 0}!d C-Pp@` 0010 2V`0SttIDPc`0PS@1V 00< P, 0:@tD@4F ԅ d D0 R/9P/@-@@TB @@tD p@-jX6Sp @PS S X6PSO0SP 0S0 0p 0d, 0Z< /@tD0Sܢ 8 4 0 - M  Ѝ/@ ,  T O-MHcH 0S 4# 0$ `Q  B.H˜@P  B.˜@P  .B˜@ P t | $9Slr,h 0`PE 0 $ 5S]`@ >00  5@S `0P$9Q~ Spau s ?S@èQb?@S_ʄaPc |a 5S@lQP5@S_HaQ @O 8<S@0Q>8<@S_@ > 2S@P-2@S_lЍO- + `0SQP@0 ! `0@SPD ЍO @tD? Ԇ @4F, @ t ܇ tD  d @D hD@dE E@E jE |E  `0-^ *$ɒ\t R tQ  Q> R0@tDO-M Mύd0 0`1PpFP1 P@ )0nS&*0S000@T_!  h <APh 0lP @(0 P (0oS 0TpXvލ Ѝ| (0P0(0k_2p  0E8 I 0E( D  0Ĉ ̈ ,  dO-MM, P0 BOA8 d`H0Hhl`L@Ppx0U0 D0X(HL(PHD0 0j0P@,0F=80 0C <0:HH7PP40$ xG0(0?00,( Hu0P< HPghh l0P`'0hp' 0h`'0h0@ 0h 08'TP,U @0 h0'0EPڈFh& PP$h+05Pڸf(  020 x0h]5 h020n?S50 X540( QN$9 S( @H&P(k>00C (0 ;H2H  PP'?eh@Ph l0S0|%PWP0\%QX`  H <H PU`H %`P&5 S@ 0 /C"((%!F=80 F"C"(< Ch!<0 \"C"(P C@!a<0 al"C"(` C!A<0 A"C"(ᘀ Cf =80 冝"C"( CJ @ ,"( 800 0 @tDԈ 0^ @DtD ,  Ĉ PtD 6F6F 6F6F( 7F7F4 E@ hDL jEX |E< dd (^  X0@-0S @Di\<\0\ , }  @tD!<7F P  @- @  } @ h 00S  @tD|  $ 00S  @tD  < 00S  @tD  X p 000S/  000S/  0P/@tDC- Mxq0SK $)Rxp5S2NP` w>D@  h 5`S P0@$9Q~Sp000CS*ꀵT(O 000S! ЍE 000Sh: h000Spd<\/ <000S Ѝ @tD 7F؊ 6FĊ 6F O-PMM PI P P= @܍Ѝ0Uh@T$50S T  50G 0Sk @DTh@M @܍Ѝ/ 0@ P7@ 80$YPR8|Z4P|4PpL4 @h ܍ЍHJ[D[4Zrp /b/ 0S3h@@ 3 3</ P / [E `3h@p#0r`#0mL#PpPn_x`@ 0 0 0@W `0P0G0002$9SHx2x0 0 0R 2 Q$9 S 7 0R0S xnX2N P` ZP ZP .[DyZP `X P0@0[ 0p 0 AXp$ 0hP`  0S `@0S S S$P L00P0S  0 C0Q R 0S S 0@X #$h@0S\ 0@ 0 (^ @tD!|E!<7FP ą   ,  d@D 8 ` E p jE hD@-@(g$0Z<@} @  @tDȋ 8@-P@HZ0/S0/S S 008/Q" 0 Q0@ /R /R R  /Q  Q0 0 80 00@-p P@Z  `. U `  0N^S ć%^ QA-`MP< @pZ0 0S  S@U0SЍ\ `  0@-P M@ Z0S  R 0aS(? l##Sc Ѝ0 Ѝ0@B@-@@MqY@00#YT ( Pv.$0 0 Z@Ѝd 0@-@DMTY@00#YT ( Pv. P$0  0 @ rZDЍ04c p@-HMH0`4#cY0 $@ ,0(Pv. 0P@ WZHЍp4c 0@-@DMY@00#GYT ( Pv. P$0  0 @ :ZDЍ0| @-@@MX@00#)YT $ P 0  Z@Ѝ蘎 8@-P@YS0 1!Sb8b8@-AM@p`YTPPP  X<@ QDAߍR@-\  B@0@\ 0S@00@ @0P/TC 8@-P@T 7Y0 ! @T88@-P@T %Y0 ! @T8p@-P@T `Y^ \  \ 0Sp@Tp0P @-@Y P/ᰎ 0P p@-@P`YPpp/ P07p/@-Rp Mp`@P0p# Q07 0 S70 XT Ѝ@-Pp@XP``VڰX @EP0 0R9Q0A7A9Q00A70A2R08@-@XPPڕX 019S0C7CR  89P7@0@/@@- 00Ba@Bs ^0TABW0B^70Bs QA-p@``P@PhU /U00xSp `O-Mp@`@ZXP . W9 0GS;Y;`F P0WN Tp PY0OoB S S,S PY0NЍ /WTp ЍЍ8@-@PW@E P0!0Q9R0B7B!9R00B70B2Q08@-A0 0"" C    CS0 0䰎 -0A@:@ S""    00䰎 0S 00C S R0S0 C//P 0S @-@S@ ^0S //@-@PLM< W0@S80S5 .S0S^, V . pP`0S 00C S  Q0S0CyWP@@P@T  zVPWLЍLЍ8@-PU8@P VP VV0080S/S 0S/A-`@`@PQl@Q P P@U`UU1U[ U ppQS `@WT! :QQ !?PLP??@C@Q; `!?PP?@U`U, U ppQ `@WT!:Q `p&?WQ !?PP??@Y?Fꠀpꐀp@-M@p` @@@P@P 0bP Ѝ@-M@Pp @@@`oV @` 0KP,0S  dUЍ̎ Ď 0S 00S00/0S R  \ 00S00/Q0A R/00/0P/ R/ @S0S/0@-MP@UV IUV BUV ;U$V 4UЍ0 @-M Pp`@0    0S 0VЍЎ @- @V+@ V- 1@-M0!1jVH xUP t0STUލ@Ѝ/T@P U>#IU 0 Pv.,0  0\Uk? 0.V 1VVލ@Ѝ/ ܎ T00$,0-P0S QT$0P/0S/S$C-tMp`PW @l 0>TRSSV6 U00'~PC2PSpgS P0f0 PTR R (0R SPU 0WRStЍ0 SR R 0zR S@~ 0,S0L t ԏ 4 ` 0Q/0S/T$0/̈F-@-M@@qRT 0 0 0S RЍ@Ѝ/$ -0@- MXPZRU D0@ @S@&R Ѝ0@Ѝ/$ P @-`p\R0S@0@ P$"R0SR < -0@-xM@PR! 0xSSQU X0@ @=S@ R(QxЍ0@ Ѝ/$L A- XMp`OSp@* 0 00 00000 0R GRPQ$PQV0e  Q 0LLTSXЍ444 XЍ XЍ脑  X  \ @-$M@Q @ 8P`mQP$ P  RpP8 0SSu 0,Ġ Č8 0RPS$Ѝ R$Ѝ00 0?QPTXDHP~$Ѝ0,8 9( 4nȑ d Б ? ? ? ܑ p@-`M@P R 0ЍpO-MMpQ  P`PPb HP^ RP 0S\@ @$@(@,@Ru ,ĠČ 0X!$ *RPiP0K  S@b>a 00@ 00Q ,0 S@>`L!00 00 @P1S  dR Mߍ Mߍ00 0PP000 \`!PP\1 @ç0`p 9RMߍ4H 0w4 r (ȑ @Bt Б ? L t ? ? ( -0@-hM@tP~P  xQUP]U X0x@ @Q@B \Q(L0PhЍ0@ Ѝ/$ 8@- @ 0S 0 UP0PP8 8脌 @d -0@-xM@ PP6P 0 tpQ PU X0@ @ZQ@ Q(OxЍ0@ Ѝ/$ 00 ̓ R 0Q S /L 0@-MH@ ] 07Q@T 0S Ѝ0L t0p@-hMlPl~@ m@T 0S  1 ,Q@jThЍp$L ؒ  A-M<@`PpO 0ЍAjO$-M OЍ 8\/p@-pM@1pЍp` PO; @T  R \L@ eO 0<P P _O gK6OpЍp$L $08\/p@-pM@!pЍp` PeO @T 0S \L@ 1O 0<` P +O 3OpЍp$L  $ 8\/p@-pM@1pЍp` P1O @T  R \L@ N 0<P ]P N NpЍp$L  $0-1@-pM80S=",R \:`pLPNV7 8 -@T U \A PN` 0#PN0S 0@ @ P@ ONpЍ@Ѝ/l01 X -@T 0U Q0@ PN 0(O$$L 8 P C-`Mp 2V `NP POw@,ĠČ 2Aho OPP\2H <Pc0 P$0S@ 0  0P 1 @C000( nNP@ ` 13@OP`` |1*HH h1$Ѝ 0 00 NP $1Y 1P N 0 OPP 0@ 0@h @@Lh 0@00 l0@\ P똌 C d ȑ ē H \ t ܓ  4 Б t ? G-PMp 2U |MP P|*Ow0#44 1 O`P h AO@$0@\ 0  0@ԡD000( @ MP  1r@Odd t1iЍ 00 0 M0S$ NP/0S* M0 @C  0PEM@T  0NP 0@00Px 0.@\ @@ 8H `0@@H <=먌 C d ȑ  t  P4 Б ? @-PM@Ua LPM PIrNt0#44 1 XN@PKT N$0 S 0 `0p000( `pLP 00 0 5M0SJЍPt 0@ Tl@0P8H L0@@4 (봌 ȑ  H Б 4 ? ̔ O-MtM0@0$@L`` Mp {P0,Ġ Č0 $0S8<@CLp  ,0 ,@0P8LP 4 JMp  M 0@| 2@;0D( (0L`P00 ,0LPfHULT,r@ L붔@)4  y1[S :p0A0 $L ʍXpf @A0!0MPP3 ʍpp@0`(PP\ h1pP 0p #,S \9@ mPU S \PpJ  0ULPU @ Z TtPJ 0hpALTJ410 010Jލ  $L , $8@-@4PJU(0$ 18@J$L C-@hpP0S@H` JP TPQQWL H p@-`$P @J`Jp@aJ$L 01/L P/@-@JJ@JA-PPM, `SK@pKT%0 RS@ Pp@ J0P @ 0 zJ@0PЍ@8@-PPH00@A3/P8@ %8@ ̈FЌ  @-@`0p @\ R0`p0P\\a`\G-p1Q1@ 0@PPQ@\ `0S 0  c5P PQ@pZ0S/@-0pQ0@@d0 `J00@-PC`@cUppUpW JTp J00(0S ,Q //(P @-,0SJ/,0@-S@P M M 00jPM0SE@`\(p ;W9 ,0 S  uJ ۍЍ;   7I(0S! , RۍЍ ;(P ,0 S  IۍЍ(0S ۍЍۍЍC-11Q@#0p@PP^@0S `0S 0  cOP P^@O- Q@$p @PPY@\ `0S 0  cP PY@PP  (0C-A0QA!pPP^@0S `0S 0  cP P^@0`0@ O-M Q @$p @PPY@\ `0S 0  c`P PY@PЍP 0  +HЍO-$M Q @$p @PPY@\ `0S 0  ch`P PY@P$ЍP 0 H I $Ѝ01 /@-Q11@P 0\T@Pp@-MPQ@ `@T ^V`P 0  GЍp@Ѝpp@-PQ@ `@T ^V` 0pp8@-0s8@PlPp0Ps 0S 8Q9 A-Pp@M`l XH0 p PPЍu u u 0dd ЍH H0 4 /܌ ĕ \ @-0S0s p`@Pp0s 0S  p0pPsP8@-P0  0@P 88@-@`G 0l0` SP PP@GP=?00C70 KpGGpp@-P> @G9P 0LGP 00`G( (0U000pH뀀 o @-@F@F0@-S@ 0 Q00  R/@-@`PG 0 S0((pG00@F$ 0 R/ p@-@M `0 S <  G n00܍p$ 0 @-@0PSp OG  0R DD`GR00oFmF@jF|{ | @-@p`.G 0 S0((PG100@MF|{ | 0@-@MP0   G 00Ѝ0< H 0@-@MP0   wG 00Ѝ0T d p@-@`F b0SP F00p@F VG8 8@-@0PS.E8@Ep@-@`F 80 S((P6G00p@Ep i 00@-SM @$$ "G 00Ѝ0x j @-PpW`PE@@T@-p$M@P`EW0̠00H 00F 0Bl yFXaE0S $ЍG8 40F  $Ѝ %  0@-M@P Fp 0R  E ,0Gߍ0 ߍ0 ,0F<p 00 !/ 0 00SL ?*?@z@--Kzz@0zz@zHH ?z?犴=zM8^'z7N:5zG^'N8I I8J 8I h@J I 8@J @ ( (@ )@( )@ R0 00S0PR S00P00C?>?zjlzjzj@-j-@zjjzfz^gzNzFZ^ZzfZ^gZNzfzgzzFZzfZgZeZ%5Hzh NJJugZAe8E81 fZgj6jw7j 7 $zzzwzw3 .zz '/ @E@' (A@ (>@ R0 00S0PR S00P00z6j z $z@z^'zwC?@@@zzjzgj^GjNjzFj^gZGZZFZju@j GZ gZGzvgzwz zzzwj zzgzjZ/zwzzzMzwN@@pB@jXjzzjUZzz@--@jMzjjzzzZ5Djzj:?zzz0  z7 4  ?  ?  ?0S00S000S00S00P00P00Ѝj00Ez00Ez00EC?CjUjzzjRZzz@--@jMzjjzzzZ2Ajzj7  >  >0S00S000S00S00P00P00(Ѝz j0Zz^{M0EZj0jZ^ [M 0Ej0j^kM$0Epv@?CC?@ t zzSjjzzPZj@--@zMjjzzzZj0 0E>jzj.9zzz.  2  )>  %>  !>0S00S000S00S00P00P00Ѝz00Ez00EBC?C0@-M | :? p?@PPX= P=PP @ =P?ߍ0u>>눘 ! k 0@-M  ? >PP@lc `=P@ P =Pc?88 -ߍ0$G>l> ! Ԙ P | p@-`M d>PP@ T=P@ 8 =P6?܍p>C> ! O--"MV묂妊夲bHp $ P$0 S0dR h2h)PLB L>d$ >(P 0S,8P@&@=@D0LS00/1|/9p @!@Q @0>P=@>|=$P =0PLP )0p<1\1oS1nS fS1fS1S00 @p@ 9QP 0  )01 U@o0sV 1n0s10c@p@|lP 9W AB % ܛ 0< d Px &< \  ț & &&z Ĝ , &4(0P0PLP P 0  ` t0) h<P=@=0 ɛϠ 0 @ lPV U@W (zzggz8z zGz:!oR"!nR!R0U@s,<65p8@-P@55/8@i58@-@5DPc588@-@P5808080HPS<@   @0SD0@0D0I58p@-P@`5D\80P <Ѝ0 PP ZU u <Ѝ00S0 0J<Ѝ0蠟 O-,@lA?D0CS8A2p2 x pd0@$MPp#R% P@t|0T@,@ #1!P! B@P4`   WY*0SW  P X X Z Z 0@0 [P [I [B [; [4 [-@ Z @% S# [ 0@ j, @\@ Xp@T@ P!$Ѝ@00@0@0@0@0@0@O-,`@A?F0C MPt0 Pl<0 PiPP`X*pX U80t9*U 0St'l080n H XT H` !D4p`pU@PpH`00  N^ P`YH00SD ,  0  3  RM RQ 0 0 0Pt8 2pl\L0D fffpl\ RfV| 0Sb @0 0SfV|  RcpPX[]< 0S*t`l`S*0 fRp1p!8 `3`Ѝ 0'0 0(0Q`cl c`V`!8 30``Ѝ eO-$MĵĥtXl08 H XT !D 4 @@QH0 , aA/B BR*` Rp8 B r 0l es00 0Cs0 S )䟅ğ 3) ܗ!Ӆ4!p pGpgo``t 0fVrtXX@Tpp H@ 0Fl80 4P `0`0D` Pl0@', PA@@QH P0`0` p`l`Wx \ R80 bE#@l0P\0"`0V`!V   10  0f S `f  `00000SH$Ѝ8 2 00 01) )p pGpgot l0 B0`t l0r l80`l``  XH 0!#T0 H 8t0S`V S S l0& l0 `!l `R1#V Q \P8 `0 "Pl0@\0'"`0V`!V70$Ѝ\P8 `0 "Pl0@\0 "`0V`!V   G10  0f S `f  `0000P$Ѝ  *10  0f S `f  `000$  G- p#pG3W@pBl \0Ptl  P2:S8btl  c0="Pl0`\0!0Z!Z  00  0j  S j  00000S_ l\0, cAAAQ*tPWtPYM l2YK l \0RS8 c0!`l0P\0[!p0Wp!We0S80!Pl0`\0C!0Z!Z  ~00  0j  S j  00000S\0l S8 c0!`l0P\0!p0Wp!W   L00  0g S pg  p0000P  000  0g S pg  p000O-@Mt@@@ Yl80H0 X0T3" 0D4P@`PPH0`0pPQ` x0dP S*,aA@@ P*SS:0CsƟd0 0c|Ɵ ps0 PC`tⶐ``)0Cs0S )L,$3 З!Ӆ6!Ɵtxp l0Gg Bx0 t 0pSAl08 HP XT  D4P `@pPPH`0Qx00p  ppG\lph`0v\ R80 b Pl0`\04 p0Wp!W   o/0  0g S pg  p00000S; t YGt0 SBpW0 S} S; `0pS` x0dlXh0S# 8 0#^    ! 3 0 0CR l0 t0IRl0t Ѝ0tIlth0\0l S8 c0X Pl0`\0p0Wp!W   .0  0g S pg  p000P`0Sl P x0llp00c SE x0` h RAl0pS1#("WM ! R \ R8 b0 `l0P\0ip0Wp!W   .0  0g S pg  p0000Ѝ x0l 8 P`P0 P) )h0\ R8 b0`l0P\0 p0Wp!W   [.0  0g S pg  p0000PЍ$  O-PM| @Ty QPv 0S0r S`P t Rl,0 VB*0 0 00` tQ Pl08`CH XT@4pD`* ᰰH 弰00Sl0tPtQ0l x0 l \ `0 0th    00Ѝ R  cP`0*StpW005",0 V0p*0L D!B 0. 0l \  ,0p@-PP- @T* 0S' $0S$ 0 R000,0 q00  !`0(`p b *0R0 #pp@-@PP `VM 0SJ $0SG 0 R000,00q00/ !P0(Po@L0, D1C0 <  P;. 0l0lP\PtPhPHP|Px ` p b *0R0 `#p訟 P 0S  R//P 0S QR 00///P% G-PU p 0 0R:`hh 0@cV@$ B #0  0`VWt/P P 00 |0//?00@-#3@1PP:  R7 0S/ S S000P 0P0 0S000\ 0^$\ 0^,P00PP R!!0l0S0 0 0O-`PMs @Tp Qn 0S 0So 0/Sw  R *S(P`( ES& ISz [S/ gS] \k\\ 00U ӌ0cPbS\ t0Si\| `>Rc\v0SӴS0j 0 " 0"( 0#"0 Pp0Wp!W   ,0  0g S pg  p0000oS0c 0Ѝ\ $=00iPpPp1WP\  <Re \ 0S' S 0,0103/ 0@SRP? ЍP\ \  0\ L D!B ,t0S,,l0\00PepPp1W  +0  0gS g  000PE0(0ЍpW 00 6R;Cql 0R0+ 00b """b0 "0 l0S 00 " 0"( 0#"0  00ES0 RC !R @ 000 !R 0 ^,0S Rp0X!X   +0  0h S h  000 0 \0 , R Q:  Q 0IS0 *0  0gS g  000I   R  0 0S0{  0 P,0S \:pk0X!X   *0  0h S h  000 0 \ 0Q Q@Q @7R\, 0700\ lR8 b0pl0P\0"0X!X   ]*0  0h  S h 00000S  L60op0,0S Q":Wh 0[S0$ R/  $0 0S0<  0 P,0S \>:p0X!X   *0  0h S h  000 0 \ 0u,U `t0* ` l8 Q AP0 0    !909AaotlLQ 0 tlsSUt0SZ S S` l8 PP00`P`P`P`P`P`P`P^~*`P 0 `̌\``0\`0 L$ßr Ơ ` 2!A ao` t0l0bQ t0l ` \0S8 c0`l0\0 0 R01S  0/)0   cR0c 00 000S, `F l 0C0[ l 0<00S 0,0Sq00 0 R0 0 00 ,Ġ q000p0,0S Q:W 0t l 00g 0 [0 p00 \ `0K x  R \ lR8 bIpDP$$( `t'T B $ l 80`p p!909 tl0 BK0Qtl0E [t0S `\ 0\i 00S \0l S 8 c0pl0P\00X!X   Z(0  0h  S h 00000@ m\ R8 b0l `\  \!\  '(  0 l Rl    00S^0 a0:00ppg  [  I  'p0X!X   '0  0h S h  000 0 Ro0 00 !0 03 0 0 !0 0  z t 0000 0S ,Q \$PR  Q0  0  0 ! 0  0 0  R Ppp 0  0 R  0 0 !0, R!E  0 a0K080 a0C0\0l S8  c0S0 /000w0t0q0n0k0h 0 0 0 0 0  Q0 P0q00 URsprQP? @-@T9 qP` Q3V10p !Q   RU !0 0P |0`PQ  R p 00S/᨟ 8@-@P5 0S2 P*UEU%Q $0(3/0DQ $0(3/0@Q $0(3/08Q $0(3/0($03/0qU08IU[U gUqU U 8O-0(\ p01S408SPP ` 0SD(0 0$Q0$v`WpgWpGHQGQR V,^W(" p3/@P   2p0 AC@4T0,P L0X 0 Pp(3/ 0,8 (3/ 0L@ (3/[=D p(  03/ 08!Q h @ Re D Rb P`  $ 0 !,0X`0N 0SK $0SH 0 Sppp,p 0q00/ `0(`@L0, D1C0 <  `f& 00l`\`t`h`H`|`x ` 0c0* S  H0H 0 0  T R 1R8SPA-P 0 S"(0 0$ R"$ q Q("3/@P 9`"@X0P,0L04 T 0 P`(3/ 0,8 (3/ 0L@ (3/[=rD `( 03/08!Q i @ Rf D Rc Pa  $ p0! W`P 0SM $0SJ 0 S```,` 0q00/ "`0(`@L0, D1C0 <  `% 00l`\`t`h`H`|`x ` 0c0* S  `/H0H 0 0   T PQA-Pq `Vn 00@ 0S@  00 0(|!3/@PZ h!@C$ 0, P(3/ 0,8 (3/ 0L@ (3/D 0( 3/p8pP4 @0S1 D0S. W, , 8 $, @@ $L DD $  $0P P`0h`h&̈́pP pP 0 $˄P 0S 0@-Q Y   0o@<S. 8<P@l P L 0/P# 0S 0@-Q( , 0  Y   0o@<S. 8<P@l P L 0/A-`P PU Q@p@aDr/Tp@0DTS4Q $ T $0(3/04Sp$@0p$@ Yo@( Q, 0  0@   S. 8<P@l P L RM 1RJ8SHP8@-@P 0 S4!(0$0 (S1P$0! 01S;8R9PA-@9 0 S (0$0 (S0$0 T/.Tl0L0 p l0P$O 08# 0ihp``d0 ^s*TL@0 1 0T :g0K0 1 @R0][@`00HQ 0Sk T[  RKgPa K@ 0"Yr  R0 4s0")4Âb """bS0 SM 0! 0 T[q 0S` KR  K@`y0S` 0d! 0[W 0K@T:H@00@09@b0@T9[> 0SK wQ  Q0K S  0SK eQz  K @ )8<#0#y`V 0L00#d p Ī ܪ   ܩ B$ T p  @ < X Q   @ R40,00   00 p0S\ Q$  b (00 ,04 f (00`,0 00Sp@ `0c R ! SV1#3 RpbpbP@p "p ` P`:`^n  1P 1  0P0p 00 @0 S000Lpq 1`! T : K 1!@\ [XS9S! S T:*0K@T$*[E@0 000`R(0 a404b0b0@R !sH0T 0@9@n0w 0# 0h9@b7F 0# 0000@ pW@`0L  0$ 0R990$@0@a00  p 8<@ 0 `p S`p8<@$e0$ ( 03/P400.  &. 9 @0@a T  0@%0@0HD 0 Q9@c0m)4 @A0@ 0t@p r 2!!`T : K 2!@`V![j0\& 00l04  @ 0& 0))()0SX0* 0K`p `p 8<@ `)4@ @A0gH@@@$ )0 R0$0 S0d+@D 0 G t0@ @ A0@>00 3 0h   00 @ /΅S>TlpTl0L0 0p 'P$ 0P, 0y0`, 00s l`P8XX 0d  P$ 0, 0^@-@P Q $0S 4 R (3/$0(3/P 8@-@T P, R Q0 04 a00, a4U ,0088/8A-pPQ `VN 0SP0+ S@* 4PC ( R$ 0"00( ,0U&*00e cRp1p! \PU"0(0, Q00PS , 0 0 S  0S @b< (00 ,0e4 3(00P,00$ ( 03/P400P 0S   0 //C-@P M \ PU 0S <08 "0S<08 2`CV "CP"0CS", ͅ a0`8 <hP RaQࠃࠓ0S # 2R Q RQࠃࠓh hPU``V 0 Q  bR0UQ RࠃࠓQ R0h R c0 " Q( , 0  0o}` P   S. 8<`l P L 0 Ѝ<0Sd ~h RࠃࠓP 0S R /<o//QPA-p@W PUT 0SQ $ RN (X!3/`PJ 4X 0$ ( 03/P@ 0 0@ 0S@  00 LS>Q*l X0c0S>0l0  $04#4`n-< R:P c c SS. LP ($03/P 0S o-//P 0S < R@ R@ b//O-RM00 @DHLPTX\ @QSA0Y5SN5S5S5S5S5S5S4S4S4S4S4StW4S@Pp 0 0ЍQ#`,sJtwJTၠuJDአtJአ~JአqJአ|Jአ{J Ქደz JደzJደzJደzJደz$Jደz(JiY oᩒVYs0pwpPuP@t@<00s0q0@ @|4P P~@8ppt@PG@uP pwp $y (z6048<0 R㾷ἧẗwW6F 0 PJQ Q@BA00SPc PZ|Wp@4P8,@PjX_o@!R4 pS  pR@(P p>@o0%SP5Lp 0$,0 S q< `04@8P @Է<@<007 P0aOa1P00>S  pQ}pa!\ 10S%: 0 S\S \[\Ṑ ^:  QQ Z 0S* X\+Px:Q-   1`˔\@HP `3pQ}0pa!\ 10S%: 0 P\P \[\Ṑ ^:  QQ Z 0S*X  \ A`;X  \;0  Q=Q-0 0R "02s 6y0r & 00P`QP p0` !\ 1V$:; 0 S\P \[\Ḁ^: QQZ V* \V0Q=00^@0Q=00^a0Q=00W^P 0 BP \ˁ  P`  0 0S X ?Q= 0 0 0100V0W0|Ɵ弰\hƟ弰 l 0# 000#0 QZ FFYYY>   0 0 0F P 0SP 0SP 0SJ FY01SD FY01S> FY01S8 FY01S2 FY01S, FY01S& FY01S  FY01S FY01S FY01S FY01S FY01S01 F0C 1  P0 J BZ VP" ೮胟0zS /! 2@ W 0C\ l,`SY `I-=ll#局pሀxpwp`p>wp` v`P`v`P uPPuP ~~  || pp q q洒 r 湠 r z泐አz y00ቐy0sh2 剐 y沂 P0r 渀 sr0rp0wp@pwp@@bRᴣḓ3sC 0@A 00S @PP @0S \DЍ Y>`,,0S0  \+` Q-NP P0PI!?Q= 0夐嘀 0  0100S0R0 ʹ R 0#0 P k!=TP< > N T V X G-&nP@唠(p `0$ ,8{0k0S  0&-xS0 0.LS P4@44440P   L A-AQs0 \`8̆^| 0H^@@ 0r @0P(a(q0r,T``P0PP@0,,Ġ@R@ 0Q̆`|pp`p&dp `nS< Ns0^0@P(P 00@.@00@- R R0| @@,ĠA0@ @PP @@P$DP @00@- R00P@"Pr P 0@ P$DP@0 c^" 0Cr S 00!S00 S0@ 0@,ĠA0@0 S"r 0 0 @@0@Pl $DP@0 0CS00@4 @@P$DP@0 00O-@ MP P,0S `ok+Q0R`3 +$$$z唀 P P 0S ` \P ^Q Q! P 0S `h9(+&Q0pR`3 +y P P 0S ` RP RQ Q! P 0S P80SD80S880S,80S 80S80S80S70S70S70S70S70S70S70S70S70S 7 0 0!1R !R=:\:  0  70S  0&-xS0 0.LS `Ɵ6U`    Ѝ R Ѻ   » Ѻ  R Ѻ   » Ѻ BP S L&0 S@Ɵ~0~ S0({+lBv`3şs0000弐)0cV 0Cp S0w`3şs0000弐\)0cV 0Cp S0Aq3`s0000`&d`0c\Π| 0C0oa`3s00 00尠*0cV̠ 0C|Q0 S`ʧoa`ÌQ|`0`0&m`  !00SSڬ#0 0#00 Ѝp3p Rrʱ|  L-c 0 0# P0S +R+R ,R  S  E/ 0R  , |3`s0p0p00`p&dp`0({c\Π 0C| S0 +B| b0p S 0wa0p S 0#Hqp004p"r ` `  `.` bP B z01 0 !X N     | ~  p@-@ 0`P@Q @  0 , ! AQ!ѕ"хX0!H0, 00Ccop!909$  /᠟ U/0`/T ,  RG- Hpd Q RR  0Q@2P2 @7&c2@@cȂRrW0V-BVm0 B0P           0 S@0ă7ac 2R0l@cR 1P @@t1@TLD@DRS0PPpP`P``P`` P` ` P` ` P``P`L\@00B#2 B"B    0Q@@0ă'7bc "2b@c Bq8@-R?'P@ 0Xu$1Ǡ 6lŒ%X blt@ T<0L DDP D@4S ,0 ,| Q , ?0O-XT@D0tM4 a( ,, 4``LD`F(` nT(p$0 B@DNa C `E80< LPPP$@< 0@ ,@@`HLX `8R 0$Q3< l@@IAQ30 `2   \ۅ2A3<  lRM<  3> n K̠L 30 `?@  80 X[1: 80   808 @a@ `X``!!B2 h0h @80< tЍ 0 \ @2\@ۅ > l`F`@ @@ @j^ l30 0 0@0 00T 06,00 0@0000T 0#0 000@00oP00j000T 0 000 0S0 K0   H-M 00 00 0 00S S S0 0n 00i00d00`] 00 0SKH-4M0 4 8 <0 00 000 00S 0040S00 000 0S 0S 0S0800 00 00S_000000 0S0 0000 0 00 0 000 S 000 S 0@0000C0 0@0000C00 S 0@0000C00 S 008'0S00 0  00S000 0S 00S 0S 0S00000R0$0 $0S000$+00(0 0@00g00C00 S 0@00[00C0 00 0 000 S 000 S 00;@00"0T00;0 00#@00"0T00#0 0@0000C0 0@0000C00 S 0@0000C00 S 000"S00 0 0@0000C00"S 0@0000C0 00<0(  00$0KH-M   0 t00 0S0 0 0S  0  0KH-M   0 th00 0S0 0` 0S  0  0KH-M   0 lA00 0S0 09 0S@{0{ 0KH-M   0 400 0S0B 0 0S6<0S 0S 0S 0S0  0S x0S d0S P0S0 . 0K $ ( , 4 8 < @ H-SMH L P! T1 d00 0S0 0<0 < #00 H10 00S 00PO0S00 00 000 0S 0S 0S;0 0 000 0S00  0 00S S S 0 0$0 00$0 00$0 0$0 00S $00C$ 00 S000 0S00L0 0 0 0S0Z0 0S`=\=00 L1S2 00 0 000 0S0<0  0 LF000 0 0 0S0&0 0L@000, 00 0 0 000 0S0 0  0 P000 0 00S000P00 T1S2 0 0 000 0S00  0 T000 0 0 0S00 0T@00+ 00 0 0 000 0S00  0 000 0 00S000Z00o0 0 00S0}00E@00) 0  i00 0 0 00 00SY(0S0]00k00]0(0 00(00 0 000 S 000 S 0@00H00C0 0@00=00C00 S 0@00100C00 S 000S00 00((K000 0S 00S 0S 0S00S-0 @0 000C00 S! 0 0-K0 @0 000_ 0 0 =K@008' 00S 0 0 00  00S 0 0@ 0 00T 00 00 0 T1S2 0 0 000 0S00  0 T00r0 0 0 0S00 0TH@00% 0 0 W0 0 000 0S0c0  0 m00?0 0 00S0M00X00*0 0 00S0800@B00$ 0  $00,0 00200000 00S00000@0000C00 S 0@0000C0 00;s@00"m0T00;e0 00#]@00"W0T00#O0 0@0000C0 0@0000C00 S 0@0000C00 S 00040 0,  000g0 40080 00,0 00C 00 S00C 0 000 00 S 00 S ;@"0T;0 #@"0T#0 a00C 0 Y00C 00 S P00C 00 S G@8D000000 00S0&00800^0+000 0 00S0 0000G,00 C0KH L P T 8@-0P @2PS Mp 8$F88+8 ?88X t \ 8@-0S00D0D@DD@P@P@ 00PT8D/ @$T%X#&0%L/RQ/@- \S^\`@TT@0 00<0  @@$T@@ D/ L/8@-$P0S8@CT@8@8D/h0p@-M RT T`TPT@TT`P@ S;=PЍpD/ &@$T%0%X#P --M0 0b=Ѝ Ѝ/+/O-@P$M+ @0S l7$ЍDPUM #  P= ` p@Pp ?W P [  P 0Sn P ` P`+`   P [ [0 O  YePPDP P/;--M0  0bЍ Ѝ/p@-Ppap03/@PT 0 3/PD7 `PЍp`V`Ѝp   00@-<0P@  RP@ 0 Cπ0<0P@  RP@ 0 09!8'00@-SCM` 1P@S ppP NPA `0x5CߍCߍ pM PP 0P-P  0W5"P 0L5CߍX0 P QP 0   G/PP 0#5 8 0@-M0@  #PP04Ѝ0 4Ѝ0 d p@-M@ET( D0S h0 @ P`| W 0S@5 x1V@STAt  0XP Ѝp@ R 0@h0Ѝpd3p@-@PP 80S X1S e1S0e1 <p80<p@/G-@R`M @ V Rp0  0P`\  *P2S (3S ?(P# 0Pw 0xP(l 0 xP 3|00h 00K?o20 0K?o20 0S` v0P[ _x1  .P{ 0^ 0 05OP :P  0 {3 M 0 UP 0S0SX<Pd3uP%446h WH P 0 ^40Q ^4 P  F301*0S^0S %44 6&( pT 0 0C?o21%9-P`|e 80 >3(m  Pb 00 00S010S0100  00S_ ^,K00  0t2 0u T2%44 6&y0 0C?o2P1 U sU  8 0y2|U(Pq9-P`|e  0 2(`^?0<  0SNP :P H 2 42-PU(P@P%dp P00 P%44 [6& U 2-P l zP'Q D 0 L X2 ( P \   H T h O-q0Q\`\1 y   P0S P@T W"01S@T 0U PP@@TP0S P@U PPO-p@@lMQ,@U 00lЍ @` Z0   0P0l0@V0090p r0 0( %P_ Pk e,pW" 0|u 1Sp . 8,p 8 0L1 10S  mPM @U#T) T0S 1,SPP` 0 1lЍ1n0U,0pT0SU ,pWP  >@PlЍH1{y !PU,B,>Pe1 \1s 0Q A\1T1P0pL0\\ Q \ P@?PH 0U10T^?8 P   4 @- M`@ p  8PP(f0 P\1`1T  P0S001W_P0QP  P\1s i606 Ѝ$1 Ѝ\1s 0S/Q @ 00C0 01S//\ 00/ 0co/@-J/00/ @-p0@03/PP% 0 0gP` @T `0`@S !P gP $003/` A-M@ pl0 ` P V  X P00Ѝ00Ѝ 0S5 D0@-SM@ D\D0 Q 0 0 3/Ѝ Q000S0SЍ0000 3/Ѝ/O-p9MfP⅜0[4gT  @ PQ 0 00g< | Ѝ 055Ѝ R9 0C \0C S1L$MLL@MLLMLLL > b\1s0`1s -  1 >1(0S  /T1P0///)O-DM)&0,0R004080<0,0P0 @H00 P0dS  0qwpx  g ``  P`q 0S \ 0  pW; @9)6SQ  P2010P3ᴰ@0 1@| RpWXTE@x103/H0S@$Ѝ X@ 0 p@ p0ⴠSCSCX s0P0wXP `003/PPU $ @PX a0  0 |  S  0d0/P <1 R /A-@0h0P 0P  g: 0PP3 ,8 1Hse 1d.d@Tp0u@p@V <0`S88p !?ϠpB#c 0c$0T @5=ID MD  @ ŅLS@5S㆜  6 PЍ ᆜD  P H+_. 0D VDЍ+Mb?B P @- \1R Q i@1L'R /@pW @ PRbP, 2S' <0S/ P08<00hS 000 PP0P@@P 0 0 0 I80S <0S, 08 <080S Ip@-`@PP :=0`00pp@-M@ P{ /?Lb  b `#)S=9C =CQQ 05%y PЍpЍp@Mb?B@-Mq @H "c0P @ЍЍP/P/P/P///0A-@T@U `P pW a@UP 1 R /Q A-i1L'R /@0SW 0@SQPS pXpgorQ 0CS0p@1z<0S080<0Q W7  i9 _P a06`0 00e0S`0`Q@0Q 00T `a S   R00 00C 07Xp p00C0gQ 0 O-,MPSPPP y/LQ ,Ѝ`@)6S#Q5 d d0R9 0B S0B@S9R񟗤k kjijjkPjiXiihpgHggfLfee<6D ) 0SG )& { d0SP 0B Sd0dS Q R  P 0S S %SRa K> / Ч\Х ) 0 S0 1… P8PPz  RBQP@0 0k`P0S 87 f80UPS003Si 6Sf u P*P >  GP0 < C GAP0V   P ]b0"ry7 $P0G P0JP0G IP0 W0P  08U0SWU 0!t @  !`\ 7 $2/ X BPP Q~ Q   Q PGPPB PP <7PP0S`  Q  [ 0 !Pp  C + Px (0S `0 .  0M8YPPr P 0SkS6PP [ f70\PP4S}  I0SPd Pd Qaq Ur )x P>  45 85 YEE N[PP< H6YPa P`0 (7 0Q ! 0*PSv Rk[f[ 6pP lEo(5 APPcQ3S 60S  0Sm `0 04S-CPb #M 6$~\P$0S  [08050820S k1S Y  x6PP 7U1SZ0S  d6|PPv0S0S04Sm}K> Ч k'^ ^ (Z RO” I\ɠJZ  B&0 gP0S, |K>  /'c" ]PP01S !K> r 'El ' W (![P9$?Z  5[06 P7P=$ 1ZPP? 5T1$L03/1$0 $ZPP $PZ  5 P0$03/Y 㴠 $ P 2/0$ 2/0S h0$`03/0 $0YPP$xs P@ D X , G-MPpW 01 R Ѝ@T( 03)S` 6 0C?o2V0S [V@T 3 )S㈠ 6S [P D@D 00 SD 00S0X0Ѝ A-M@`PpQVwG H p! "^Pv p1)L'R Ѝ(P` @T @TЍ0S K 8"R R p0S !@ 0 R` 1@003V4````````DD 0K0 SD p0^0Q W [`P( 00Ѝ4"R R`0@- M 0 Ph@P Ѝ0 Ѝ00@- M0 0PU@P Ѝ0 Ѝ00@- M 0PC@P Ѝ0 Ѝ0[P0/h  P 0p/h  P 0/h $ A-P%N0 p`P2GP P2S O CP 0dS ;P 0dS000Sp0 C8 PA-PM p% B `ᘀ@ 0S RS3 L `R ,pP PPЍPЍ0P0L/O-rq4M@@p  @ P nS@{ 0!1ppz 001p # p 001pA # 8`U@@ pb0S QS3U0 @`T4ЍP { 1Y00z 0 !0!RY r 0 11SA84Ѝ0 4ЍIL/G-M0P00 Q | |0SЍG0R`pP@ t@ࠟV@@ kp0 S RS VZ s@`TЍP 0q r r  r 0SЍL/@- MR@B 00. 0 0S0S-0S* \ \ \)    0S0S \\00  \ 0 00  Ѝp@-MSP R`@  0RQ V  0 P`0Ѝp 0  0   0 @< A-MR P  p`f 0@S0S 0S!  PP@Ѝ0S 0 J 0@S0X00Ѝ0Ѝ R 300@QPp@-0 0s0s 0S0 \000 P@` T0 p0S P P00 R0  0 8@-@L0P03/P8T0P08  0S8 8@-@L003/PP @P 8003/88 @-@P,`pP03/p03/@U p@-@P P@PT `Pp`8@- P@ZU +8@R+8@Np/p////////p/////04/P/@-@P dY00 0@0/ 0P/0@-M@PZ R Z0PЍ00 0 0P`  @T P 0-S  0P`7 @T!ލ dPC  pPU H0S  @V 8T0`3/V0 bH0S ?V. 0  ^pP2 gH0S  V 8TH0S V03/ y  0P 0`0C0H0S V jb!ލ ` l RpO-`MI@P.0dP0 0!P0  P:Ѝp`ᐌ, 0.  >:Ѝph< 㘡 ! @ P0;,`,@0P A 8 !:Ѝp,000QP @ , pC-MX0@P`!!0R0?P0!qP0EP0N 1R0X 1R0$?A) l!9Ѝp@P!9Ѝp ʠ<ƌE0$!Pq!9ЍpA$?  9 5;A% 0 9Ѝp :6A* 0 9Ѝp ϠA 0P@l 9 ?1A/ 0< 9Ᶎ? ' X h ` x fff X@- 0C΀@PI~Jn` N F@L@Xp@-M`@PD QXpğ4<J^0 Ѝp ]ЍpK^PЍpK^ЍpK> ] ЍpK> ] ЍpK> I^ ЍpK> I^ ЍpK> J^ Ѝp0@-0 M@(5 ]X$J>0 X$ Ѝ0 @/ /RXC΀@ LX/X40-C.@P@0@BX40/RXC΀  X/X40-C.@P 0@X40/O--@M(5pPH0$t0[0bp:4 0c{: JkF>{6Es A{ Q{G>p`P0C4H{ A{ Ql 4P S0@ H0 `dA Rၰ@`MnYO F(50S(5{ Sp$r#GppC0p1 1؀F apXPPPV 07 ZikE^{{ A{ Q$0EXQ, `JC΄ L````a1/0P8Ѝ G>p`P0C>{H{ A$Ϡ?  !E^0EaV4 C^qE AJ A AI HJ+ A6/0P `Ѝ^  0 0E A0.A@@?*7A ' S  <$< >X4倐X Q  P0 RCH`s 0R0Pd 0g 0chl@ P0 CRH`AU!0R0d 0J 0JFTX$` pU0dͱV0$ V0x P%됐 0 $ X4 u C.`@t JC΄$ L`p$ 0$!0R0Td 0 0  aU @JQ \MP HJH pDE A?@0\0H0 0T0$p0X0( 0h0,P0l0004&8[= 0T $X0@ P0 CRhlPCHeV0<@ d0D ! 0` J$`ph`lpT`Xp 0j 0gV0 8d0<$! 0TXMV0@d0D$! 0hl"D= 0&p0T0X030h0l0@-0@ 4PX4P4S (< p@-@lP 03/03/0 3/03/03/03/0,3/0(3/0p@/ @-@pXPUU`0e@^P VT.@op@-P` P# ; 0S@ 5P pPP * R@ $PPpQ p@#p 0S@P R@pp@-`03/@P 0"SP$ U 0E "R 0/S/R00p0/S `003/0Pp@/  /RS PE  PE \ O-p2$0 PS$M0S㬰% 0 `堠嘐PA  tVp`\`ApX;$ЍS .R 8 (00  0 5 T L \ 8 O-0S`AT    R S 0B00X@-M@ P  ЍO-BM M` P<80$3/@P$ UB  P 0200#S @P00 :P000 S0 S S0Bލ Ѝ R p0R\\ X4԰@ı \00 S0 S S\ \\XPU0S !0 1P WPUQ \P P Q \P0S P\P P0S 0S0S  0    ؁*U} @ 00 0Bލ Ѝ\ P T P'0@ 3/0 , 3/oᨂP T\P$0.P 3/o娂v 03/o娂n 03/o娂f  ^0 R p0RX@ Y X p9 G0Su1pW10Sx 0 3/03/03/0 3/03/0 3/0(3/0,3/p7/00S0S  0    a(a5Bލ Ѝ703/PP ;0S0S S S w00 ( 0(P\(P=Ioᩒ  Q R RR A S SP 0q@SB>00 $CZ J 0 S S0rN S S^a0S0S S S 0S00 S^ H(][P 0 3/5 03/P P X 0S 0Sg0Sd S S ;zP P~,P 0 "S$ ?P X 0SP4 00R0S 4P03/P T4 00R0S T?@ P  T4/ c\P T4c403/P T g 0  P 03/0S  ;P! (ZP0 000(ZPS 0.SP4S P. P Y P P 03/\3 03/P 0$0X d00QT(ZP020JY5GP03/2 03/P:0,0Q ꤒ(03/0 3/0SP(qZP(lZP] 0,3/82 03/P,00 P= qO0e 0!40(3/1 03/P( 0!0S& 03/O 03/P ? fo娂d pL1P4o . d P 03/1 03/P [j0403/PO( ZP 0 3/0 03/P s0Sr@'T/P0 0!X003/0003/ L l T \  d   $  T 5 \ O-M@P p=T 0S Z{Z `00 0! X000S Z0 `StЍQ $0 SUYP @T) PP$ t203/P ?P   /RE@20 U0  eP( U{ 0@ 2//T1803/Pa 0 0P@ 0SP@  00 0 00 2/P$0 S(1 03/103/10P 0A03/PP$ V0E ``V`0 VD0`0 S@l0 03/Ѝ `V8P @03/TЍ0 2/ \ p0P/p@-P0`0T U@03/0Tp P/@-@00 0P/@-PUp`!@0PV`U@Pg 00C 0T`P/p@-@$P03/0p@/ G-PRM@d 0Q0S `THP. 1pW, 103/@PPC  P* XP 00  Q Q Q  \ \\PP10S00Ѝp003/Y 3/PPP `003/U YЍ003/`P t0T0 3/PP@003/ pj  ! / 8@-@TU8 K$2_P PUT8@K G @-TU P@T P0S 8`P bpP P@T 003/P G-PCTG 4S  KDcT 0SY H0S ,0P GK 6,[GP6 1p 0^@T  R `P  603/@TZQ P )D NKt5Z d#TpP 0 0$@T  t  ,0@-`@03/0P 1 00  00000/00 00000 R\ TT RR R R 9//!R/!RT10/G-A`. X0U0C ?o21 Ge0 0X H9@D `pƃtX  0` V PP`C-P!R @2S S @bP  0V00Q10 C5?Q S S S 01 0% 0<& SR <& SR qTP 0 @-`QPM4$M0 @0 001 1 .w00 0 ᶀP 0S  T@03/H0VD <<4 03/PЍ @ 5  G-X1YH€L2' \`@VP p03/03/0\0@2S S UT1S 2S " ? R?R0b" 0'b"  0'8P X080 Q4 8 p@-@P` @T P UP p UpP @-<0@ UX X0A-`H%0SpPT5: S*0 0SD@!@1T0 h2/0P HED5T` T X00TX0` 8@-01@PrP84S81@008p@-@P0BT` @T  hUP ppp@-@Pk!0R` "R B OUP@Tp Bpp@-@0:SS 0:SSS@PU 3 PU P0  <PP U "0SP P S  d0Pd03/`PP  ]00p PPPPp @-@0d CcRMi%R P!PR !S !KS  R pPS050!R pL!S !KS00S pP%05W0 KS5S1S @20S 003/P+ 05xP 003/p0 !03/P @20S 1SP 1S 0 C- M`^+ \( Yŕ\ ETŅŕ\ ETŅ^p@ 05X5S 1S\P 2S% eV( V \i 055 Ѝ!R䕕Y< Y4 051S"05SP05 0*HP1 !R   M50#5 ЍPPe01S05 0HP`00!\R  LX %50#5DP `P0 5  D 4 , O-Q|lPp`p`0S! , S@P0 0  0,SS 0,SS,SP@T @0  @T0 000 00 GP p 9 %\ SP 00000[0@ 9 L t 0 0/ p@-@PP 03/0p@/ O-@M@P@paT <1S  X019#E  M 0 0EM0   PApg2Wp!Sg$\, " 0"X7 Ɍ ptpaH@D%tFpv\P XЍ@ 0 \0V00X7 T@03/03/ Ѝ0X0 0@   0A-P R@': `R. @\U2S0Q0 3!R# 003/pW# 0  0PPP03/ 0 3/USH003/p$P03/0p3/ -0@-M0@00PP  P00@3/Ѝ0@ Ѝ/(P03/03/Ѝ0@ Ѝ/ @-@Ppj` WRP% P@U O PU P0  XP PdMU`* V  5RPE@P  >PQO-`Mpu 2SB0T6 P:$P7 [) [# 00  2S  QPP@2SC 1S8,2S p QPP TXP&@T0YF 0 A;P PU P   PU [;R:00K 1P Ѝ QPP QPP1S 1S2BS0@0 2   0~ B0zЍ 82S/@-LM`P<H@P,40 ,S0C0 01Pv(p M @ p  )82S S S TLЍ @4    ? 8 l P O-@P<1dM S040 0 3/0 2tEP X5S \PP o0P R( [R<0E :<0P $<02/<0$2 P  P 1Sp0St8  <0P@ <0p d= `0P UP0KS1S1S1S@20CS0SD(0 Q!0  01 1S 000%&82 S060`%&  ZIP`` O?~P$  dx ` CR000 SP0 0 U HP ``Z 0 06,Z0 HPܠZ7| HP `ܠZ `0 1P8`0 pHP0`0 gHPI 0`0  P0S0SD%zP0000\!RPx P OP 0S P FpP ` 0 0`[%Rȵ!Re HP 0`0s i@ HP. 3S+ 0`V `V `0 (  GP 00  0 P 4  GPB ` V! *Vb `V` 00  y<$QP b00 _0S0  0`a  O01 H pP `b d4S  GPS GP% 82S2S 0!]<2S9   gGP* 00 T`0 < TGP h!0S7  JGP-0K?CcSp1<0 `P oL  6GP 00  :$)P0<& 0  : 0S|``foobP-  600` 3/V 6Z?1X ` 0 <  < 0 h | l  0 L T  8 T   FP 0S0P R "0Rn d003/P Pd  FPy\003/ X C@-PA MT 4/ ЍQ<p` 1 >1 9 Ѝ X0@- aMo\P P. @0 CT 7=P T@-@Pa -@P ~DP YP B206B6 L'SdaJp083/08vQ+ Q*&0CQo } 0CQi % 0CQ` '0CQZ Q Q BQp Q ]Q Q {Q0 0S0|2T=Q ;0CQ T=Q 8=Q 0Q 0CQ0 1;60CQ M 0CQ 0CQ1 0CQ 0Q0 1%QB Q; `Q Q Qv0 0S03+Qz Qc nQ Q Qc? 1 Ѝ<Qt <Q x<Q 0Q 0CQJ5yP<Q D<Q8 8<Q2 0Q- 0CQ70 02Q9 Q- Q Q Q'0 3eQo kQ oQs lnQ R R R"0 x;Q? l;Q `;Q :0Q0 0 <;Q o0;Q o$;Q 0Q 0CQ 0^` R0T!3R ` ~Q :Q @:Qr 0CQ Ѝ@2Q 5QW $:Q[ 0 $1^0CQ 0CQ 0Q Ѝ@W3:Q] 20CQW 0Q DQ =Q @Q0 0S0P27Q ~Q Q0?o22 *0CQ 0CQ 0Q0 30CQ 0CQ 0QqQ PPT  T Q rQ yQ\0 0S0240CQ u-0CQ0 0QL R08|!!|11 0CQx 0CQr 0Q80 1`QC 8[Q: \Q-0 20CQ Z0CQ  0QO Q@ Q8 Q9 PQ Q  7:68< 0 0S02"Q Q !Q0 82$7Q 0CQ 0Q0 2.Q ,Q -Q0 0S02vQ=Q*Q0 02k6Q: 0Q0S 0S ^ \0CQ 0Q 86Q@ 0Q Ѝ@S26QO 0Q0 3@3QB 4Q0 0S026Q  0CQ0 (1-0CQE 0Qx 0CQ7 0Q  < T5Q| 0Qr0 3 0CQ 0Qh0 1Q[ Q`0 30CQ; 0QV3803002 KQ NQI? 1iQ jQ?0 0S020CQ9 0Q3`V ^ SR SR0 T@2Qx Q lQ\ Q L/Q3 0Q0 0S02Q Q0 3bQ cQ0 0S02)Q *Q0 0S023Q 0Q 2Q 0Q0 1sQ Q0 0S02iQ Q0 1a2Q 0Q0 1W\2Q* 0Q2 3002 H$2Q 0Q0 2>EQ  GQ0 36Q Q0 0S03,1Q 0Q 0 0S020 3PU d <`P  /90 0 0S027. Ѝ@-0 290 12/$2PIP  ''}'t'w' (NNN'''I'Q'\''''Nuu'''&('h'''')'oNN '5''  & ? (  00C S0H 1 30 10 10 19  X4  R00"X4 /^` R0T!3R ` w0 2s4SD34 i0 0S02c6Q000S2X 0 @2"V0 2R0 2N? 1H R@!D "20S  5,0S9 1#0 @1 R   *> C0 10 10 20 0S02 [Y0 10 0S02 R03p!!p11 CA0 t1;970 0S030 10 10 20 0S020 0S020 0S020 810 0S02y0 ,1u0 3q0 2m0 2iH0PS  L.<0$S080<0H0,0Q $)`P`  B F.UHP  ..H0    < , 8R H0, $0 R49p`%$. '0 0S01!0 0S030 0S030 30 1 0 4240S1) 0P4 0T1=0@2 0 20 41  > 0 10 30S1 P$c0 0S020SD2  0Se 0@2""1L0 10 0S020 H1 R!K@8010 X10 2, Ѝ@.0S S2 0 0 x10 30 1 Ѝ@.9 P{0 0S03u0So 0 @2"m0 1i0 0S03_> Y0 2U0 1M0?o22 G0 2CGZ? =0 0S027*> C10 2- 4SH g@34 0 010 0S020 <20 0S02 0*CQ 2"0@2  8pP<  ,), "* 0;03/044lP;03/04 4R+ " "  ; 03/pP Ds8`P  8PBQC ,<03/PP3 4S0  , ` 8 P 000 0b,<03/ 0T10T1  0D =03/ h] d 0P* p@-PU `H@Q q0H0100S 3/D L0@3Pp48/` 8"48@- r@ R1P@<07 TP D P(p8QP8x @- Q Q @-0S0S Q c)//02A-@S`12S-84AO1RUp8PP 4PPAzC8PPPP681S- M 810CSxDTDDTD Ѝ4 00r50 0040 00042S/1- MSD0  X0 Ѝ 1 0S //0P 1$0S //0P  10S /00/0P  10S /00/8@-001S1 S 1P008S 8@PTP81S 1S10S 3/P 800014Sp@-@$`P03/0Q3/Qp G-@`Mp1@0P4`3PSQ 1 03/ R`P * <〠 T1Qs P 010T宻D0Ѝ000Ѝ0ЍҡHP 0 O-`PylX @03/03/0DS>1 0S  3/@*T TP*@[0 H0Ql6 0H00h3/2 h%S10(  00T0S@``03/a03/a 3 R824" 0 s 2S1S@ p0S 0@p1S 0% S :1D @eS00D8|0P PV@u  Q0A- 19MQl&(&0@PP@2@2S0@2 80 `pD-E< M0P 0gᤀPI  0L 0EЍO-@AMP@@`p0`@d@K @K@Z$ ?03/@P| x/0X!T1X1\1`1D000 Ɂl8Õ2S/\P81z Rw S00ˁx#l P 1Q2!"́3!@{P <2Ss &4&42SP8r P >03/Ph Z?l;!(018 <0@厶P083/=8<0 3/ P8[ =< 03/PU > 03/>0` 3/=0d 3/d0` RS00K01 03/0d3/0`3/03/YY0 P 00 Aߍ< 03/P<42ጼ}&8z&0 4282<2/03/03/083/ 8<0Y 0AߍP p0t0x0|00<&S, S S  S S 0Sp ,0P , 0 p Pp08400ژ@ ?P P ׵<,Ե< ,00 ,0<   ,0 / ?R 3S 00S+ ,嶵<峵0尵80S4媵t:0 03/0P00D  00, <0 ڴ4S40( 040l00嘐@ h0劵P8 "0R03 i0 0Ah l0PrhQ 011 0% Pe 0`3/`lQ 0 PX 0d3/dQ 0 PK 03/0h3/0l3/03/0[S 3,S0#<P #5P옟80@,P4@ P`PU` 3P ` ,P<00@# X%R #4 VQ0h3/0l3/03/,0 R 70 , 000 )p$3P ,00/S ,/P 0/S ״0807 40 ,,7YPn ,ѳPb 083/,8<,P, Ẵ  /00 ,0ϴ P 3S40' 080%㩴Pd   aP0<0 0<0<0l0 @0労l@0 ]R0 0  㴴00]0@0側P @000'0P 0@0p<00j0 ᔳ@00& 03/03/04480SO1@0@ 0?9<PP00P d503/P, 1SQ8YU 45 03/0P,0 Q *P3Sv ,03/011111@0 1S01p H4Pp]Q  JP1S$P :Y ,ݳ,0 ! :Y4S04M/P Q Pl P? P$1 4 Q,7 4 ,000Q#  0d 0P,0E 03/,00S 1@0,埲P, , 2P 081 @㜳0P 00H <i# p pP 0p3/03/,03/(003/0pQ 4s4Pf203/0PD 043/4 Q 4^4P_103/441S. 01p03/0 03/0[S0 :HP < 00"0 C0S 00/R00S S0003/P 0,3/81S01ą1ą01P  ` 0 X $ 0 T  ` o  \ p  8 @ ( 5 T `  Bh p ` 0 0 < ,  \ :@81S %R s0\0001S: 00001S000 2SA02SD0I0 0  0! 1!0R,0 0P!P@(X^<0, qP6 4S 03/04l3S 0`3/1l03/P` p3S 0d3/1p03/Pd t3S 03/2t03/P "0R1;!`d@  !Rc X203/d"P 9 0 3/$ 1S $1S 0S= 0S 0S03/0103/ PW1 R 2/P1 lR8 R!#ұ @ h#lp!t!* 03/Pc01P04qPP 1  0 3/ 03/0d3/0`3/03/Y42 0S 82 0S0S Aߍ 00YP P\>   ,ΰ,P*0Y000 -00/S /㷱P$1S0$, 0P 081 0R004 o 4 8 Rh 0:R.R09?%R4  GP40 RQ 80 RK _R~R00- BR   00S ]R9 1<01S`6101>0TP 0 :Ss 81S %R s00u0,3/,D},0S`d 43P6ʾ011`d$p, 0P- 081o 007 03/P( 04'0L703/7P  03/$ HL#d3hTX"\X#\2T3`Hdh"l2&VPn 000T05 0 kP0(r0 05 02S X5S lP " p0P 0S @ ,R0  S4 000P0Y Q?Q7 Qp 0@``0 D040, P L08 D0p0D0P48"Y PPz P  Q9 RR P 6 P @@ ! <k<PQ  %PPY@QQ (0 P^QP ,P Q @!R !R !R}!R 88!Q!Q.P  QYw Uu 40  U3"Q_  qUoT!r! R D  d , .Pb 081;4O,00/S ,0 ɯ , 0/S080<40<幯< 000uX 03/  0[ =_ B000T T PRM L0ULP5Pp5P8f0PK Pp(kP @03/000x0,`P @ ( Y @0S0 Q? (0P@(\@P `, P 34 ,P 080340 00YV  ,P240 ,2"8P 4 U,P|  QwJ,P !<垮!< P!R ;,P  Q!@ n HRP |!R0,0c  P $$P5(0P. @0P 3S dnPgDdP0PS85?5/C-E~ M؀G@ `X0S^1S1PS Ѝ1స ЍP1P ؀GX  =1`Q! L@-0S 04 S00$0@@#H0@l/0 @-40S(0@@#0l/0 p/0 R  /l/ @- 0P 0S 0@0/ O-PR M d2 03/`P @J P0p- CQR^<<<<<<<<<<<<<<<<0P00d 0z@00 Ѝ[ 00刀 2/0 P `l PṩL00 3/`P Yw00 03/  Ѝ   WO- MR@4pPᒩP(103/P* `U7 Hu %   P`U@" V% L/o" RP\  R x003/ Ѝ0  0R@PE00S0 000 Ѝ 0@-M@ @,P@ 0PU Ѝ0Ѝ00 000/ p0P1 5#05 8 202 8/p@-@`pPV 0 R*P000pt003/P  0`  @0 03/P 0`0`00 0p 0p0000/p@-@PȨ @ `0@00;s0SR $P p `pp -- M 0 } ЍЍ/O-M MP@Z?h p 0h0P%S  RU͍ U0 SS 0L S |||@|(0@0 R\0$00`(0Z?0P?D 0P %P2 8/p D0PDP%P 8/pލ Ѝ@0@L0  Qi @f">"S9 0  @  @0D0 %R DQP0@0` 000 . 1{;01;(0 0 1;01;0 @01<0CSܐ`؇؇[pK PAT " 8/p P0 `00Ds@0@L]0%S h`h `P0 0UP BZQn 0 01;0U D8/p DPEB0C `3P}40`00000000000d0000t0000000000ԗ00000Ж00l000 h BZR/D8dlllllllll0h0  9 @`%H$0 0(L0P0T0X000Q0O O01;010   !- I J`I`+  `   `R#  ` S '``Z 0'` l00`  E0e00 H0hA!ЦhPh h@PPb 8/p @0. 19 ;PPPN O0A8СD 0S@E@PU 8/p 0. 1ZN d6 ( C0` 00,00 r000h040@ 0 ?8P P00ZJʘzP 8/Jp,l h 0劤jh0 ``` 0*R h uih0 l``h0~ih0P  U P``~@L`a `  ` 0I0`    0@1` ? 000 0000o0 0 @ ?   O01;dR !+ !^+ 00,0`S. 1;m A`FV`F vP 8/`Fpp,0S/ 8/pc  G0g00V[pK P pVP P 8/pH0S ZP U 8/p8 V`PU 8/p).     5   hhih0P 0U 0P0AV`Fʟ0 8/p   X 8/p " 8/p PV`FʔvP 0 8/`Fp<Z 0z000 `,0'f00-`a`a A`a`a`a`0`@CY T@CUtPR 8/@Dp]q  Q RN  @+p lc x 8/pF P:F ,0030 ` 0+ 8/p5000`F@D@z 8/pJ Pz 8/p# 0@S=P@T 8/p0(\tPP 8/pd0, `I0, 004 ` 0AVbT`@PU[ 8/p00,0 `.POP@-M@ ,@| 0S  S0@C@Ѝ--M$0  bp 0S  R  0ЍЍ/P @003/ЍЍ/ 0 03/ЍЍ/$ 5 -M 0  .p 0S R 0ЍP 0003/Ѝ003/Ѝ$ 5 --M 0   0 Ѝ Ѝ/-0 - M 0  ЍЍ/ `)--M 0 Ѝ Ѝ/`)- M0, 0 Ѝ 0 `)0 `)01S p@-Z@ (0`l03/0ap/ C-@aM| @} @x1SQk0BTp )  jn 0',h8@T  0PPE  P  P  j( P만@0T8aߍ \ P j 偸PI 0 8 $ P r=( *0P08  P)  Pj 1j1@ n0UWC"Q "!uEP PUXU P ph'X0HS@"T1 H ['Ux0ES "1 N  PJ R0$>0#SA 'S S= UP@ /TW &xC!0S`UP@R@-T  R  00000 Wk 0 $4W_40<!0,!x      L,  x 4  l d ` D  C-Q` Mp]r]zM10ʌ0@ T,>02 0T.T>T>T>T >TÅ>>導QT 9 P3 |T7 9P Ѝ0h0C>;T  ЍCh48 c0Ḑ).  @-BMT R 0S * S* S S* ЍC\ 0 0Ѝ@x0'\ ` Q XЍ\ <4000,(0  @-` MP@ 9P@p傠P 0  Ѝ迟  O-M M@`| @忟| @废2AZS.>3 .p#W 'W5 WK@ ލ ЍK(@tF0 0 ! @pP 93P\2S  0>ލ Ѝ0cr-00 <> 0F 0p@!0LTF ,p@T 2P U  0JP 000000g 0_@pTg@00 0S 9ߟP2S  0>L I4 C$@p , < $ `;O-@T!M@0<P, 3/ P :r0!΃HDHD DH1 <0kP z1pPSG[ d0@(@ 0= T00$ $940p 壳pR P= 7< d00 , 8:5QP9 Pld0S0 $ļ0d$01[00, z-r=00P0T00 p08 @ Xj>PS[\xl@d(0dSN7k@1S4 ὼPT0 00 0 0 ЍU>8 X U S *  8 >R .PÅ>0C>P0$>0 T0>0ES񟗳ر̱UE U0>y@ T 0sX 0c tP @ 0$00 !!0Sg SW S0T *븎h 0$00 0S\ SR S8S :8S 0 T  0$00 1!<S S S0T  0$00 !!<S S S:4S< 0T 0 T U0>v >8 S 2.5P5oU㸎jy  0 0iPe`0>]0>Z0>W0>TP 0.>O긎K9 tP 垝?(PG 0x<00S <0PU0`pAK@<S (V P`@U 0S !!Q Q Qp T 0k1@S hPᰶS? ȶ1P 8e {P*40$pƓt6R  Å>0C> P0>T50y>W N*v0S S 0 T0<0S S0S S<0S S 0 T4S7 S0 T 4S) S4S0 S04S- S*0 T긎0$t ]QS2 35 50>I0r !!Q7 Q0 Q | T 0:  8S[ W0 T 0| M@@0 0T \n\ʌ8S><0  *Q0*0SQ44SX ?H  h O-CM MYP S 0S 0@p`0 08 PS 0 800P%:TW. Y8 ph P P Q Q Q-T  P`@@ zP@ tP@` 0S  0)R0p) p103/1 03/P`Cލ Ѝh PPpT JP0 0  C0P00@@103/0 03/P`Cލ Ѝ`P  09p0@3/T lڛ03/VԚ008 ;CP0S 40003/`P! \ `  h p T \ | 42 | @-IB>`pPeffggdhVVVV03/VVVVVWW8W -0P0@-ML @0 6S 7SH S@P0U0; 06C0C(S50 lX@,SD S@0T0 5 R 00Ѝ0@ Ѝ/ 0R0 06C0C(Sꔿp\H4$P0U0 05C0CS񟗺ܾP0U0 06C0CS񟗜ؿĿ|`<(ぞ0yᓆ0X4@t C>CኆG>ᆆ0G>Cဆ0=Cz0=t0I0' I0X& I0T& I0P& I0& ٝ0I0& I0|% I0& I0& I08' I0& I0& I0& I0& D!0 I0& L"0 ,P 5 0S  ?S  0 S SQ  0S/ G-P0@S `+%20p0@0S S ?S`Vp0@@S00 @E C-`@M 1pS9 `F pƓt6 V,:1S% 1S" 2SH ! 1X0  !  ` f ȘP UP00PЍ00Ѝ0*0Ѝ1@0  !0R 001 0C1Ѝ$ ;  0@-0@1 M0T0Q0 Ѝ0@2S X\  0 1S 1SX00<0' 0S$@X!0S%SRr t!DЍ "0P $0@`0S~ صP! *DЍ82S D6S  0"00R 0Sy 0D%pQ0Sp 1Sv0S 0S'0 QP < ?R `` ` 0) P QC C?Q0C<E<U 0'] 1S<0S0SY14V\ !R@ U<0   0 0P0S 0,0PS 0S&SR  R  0D%ZPd0S00 <0p 1S @ 800Pms~000X0x  0@刡Pn  X@2 h@!d?PЇ Z 0 RR < '0s0S 0P)$0|0< ;0;iP14\ &R0;0S0Sd 0Sa'.0,P000S (00S\0 0$0@`U XQ' hQ ' ᶴP P0S2SnХ[Z] Ї [ZY  0YXR QO Z 0w< ?n7DЍ0S31<0  <00P0 0S0@ˠP$ ХɄ<6Ч<  L !@20f@2 `1Sy  (0 0 r 1S 0S #N7P^0( 3000DЍ<0S? :0R Їe` UPt511<01!P2S'< ?SR'  Q l T0P>0Ɂ00(00 !00R sPy< y ɲC$0|0 蛮3Px0 00 o0D%N'Х! '`< 0@00`( :0, 8P(`>`6,Pxa0< rA0 00(0 10 03/Pt h|0"  p  (   \      X $ L D  10@-,0S 0@/R@ PP0"  * R 0"Q S 0S- @- EK`AUpV #-A3P@P0Ϡ ᲀP0QP@PPR0@P #-A3@P/@P9|,!pt&/4p@-S@# 1<@!Y`Da0%Xexe$fe3/@2,S>>f4S R4S ữP pp05P:ᢱQ Q %5ŕ 0%5pᐠ፠  /RO-Mps  0sP 403/P BP` @/T ?E/P00@?T /P00@5P .T` P $40@3/P  \0/S V+ R(c 03/03/YIP 4SP Th&6`#S  SH  BS  ᫰Ѝ?S/00@H!D1r R-ھI0 QX%D1} 4S203/P0 4qЍ{203/P lb03/YI05yж</Ѝ@2S L12"Q@R  `R.T`j0/SPZ .Se0/Sb@0.S0/S0@.S VR@TO /PHwP`P?B03/f@20CSsL1p@20CSkL1h0@2b0/S00P# P?@P K0PPT0l003/04 4c0P.S05P @P0 03/[  .   0p@-M`@t0<0P Q0 P7P Ѝp 0PP0SЍp< p@-0@02S !0< 0S& ' ?0 1S 2S3 S `Pl d003/P !01< 1 1"0pp@.pl @- MPqp(0Ts1` @T1$,R2!eXhV0  0֯!R2S2s0002s 9!(6S000 Ѝ1<0 X0S 0000 0 Ѝ@蒞@-o@-o@-@eP l3P/0p@-S@ 3/000 P 0 0,`P03/0P3/PPPp 0000 0/O-M2@P S` 0S 0 0ST< |@0 S S  S 0 000Ѝ0 S( `VPp0 S SX3wS P# XX3P# XX3P#2S 0 X# 00 S0 S 0Ѝ0 Sc S "R0S2Sh " R0 `V p"0 P 00 S"000 X3 0 0A0C0B QS00 RT  0  @1 QPD 0 0h0SS`V0 Pp0]T#SR7 <1T0P3/P? X3 P0000 0g DP#X_0 P6 0Ѝ 0 P `VPp;]0"S0j0T3X003/P#X3PP 0Y0WV00Q @P0/  8@-P0@S 0Q0 03/H 0000 2/ 00C 080S00 ,0@-@03/P0@ 000 0p@-@0 P`3/Pp `\ U  P  R  p P  Q @- 0S /p@-@PP QP 0p@0/p /Q, \ @-^ @@@T L P   /\^@@/A-@DPp03/`P` 2/` 0 A/ RQ= C- \S@@`p 0@`3/P) VP@T :P1ST@D `o0V`HP8003/000/  G-`p @İ?0cp01N @cR  G{>GsR0C¯ JB!ȃj 1Aw/B1 B 000C012c12cp~  r R10bSr0r0I Rlwj#P< r 00 0pys2PC0 PY0sfR`` V` 0 P `k rw4 rX R4 R1"P00  FPv }ҽ [ kBoPQ [+ A !+Ao /"bd "bl!Pa"b!%00.TЍ, $ (0HP! ,0s $ (0 P, @R u0 0 0/00Gvb"b0cd 0 f?2c 00P C0h p0 $(,rv00w0009P  *Q k x  h' - M0#}P+ Ѝdp P P P PJ/bp P PD/P F/cp //E/H//P */I/G/p@-`CT 4PH`03/0LHa3/La03/p RT10/0Ap@-@M`Qb8\ #0p 0r 0> 0RWb 0 0ЍpL1PSPPL1  L9!L4LPMPE0,05ЍpL1PPL1 L9!L4LP000ЍpH1P 0Ts0S00( U"  !GЍp4!0L 0 9Pĉ帝 7Ѝp L1 S L1  L9!L4LPP@18!0S000,ƈ   | A-@M$`予0oob 㰌PFV+PI ,Q}(a0ES`%o`f$p `(V` `2V20` 0u P00, 0gBkᆈЍP}`0$pES`%(o`fV0` 0 `tP000(kЍ-n^Mbgfff4 8@-@04 P,700P88@p   0ApC-@M`Sghh#0 0r 0 0R]b 0 0ЍpL1`P`PL1  L 9!L4LP#`ЍpQ03H L!000L!#L"ĠL #@RЍ0bpSp0 0ƚp< P `3@!H0(pp ,姅41S8> P1H!00A S@b 0 0oЍ@@@ @ 0]Ѝ+ W0 0hP0 0 vP $p( 884qP 30 s0S0@ RpP'8A 0;P I*q  < @1@ pP` DŽ0P @"SwSoD!Sg$@1 "־YS*Pi P@i@UM`h ܅@Pf@UA: ᎅ@;  0 ᱾ Ⴥ| qPP {` iP  }<PЍ 5 % % % A-P@`|Up|000  0  SU 0 S@U* P 0 S`oO-@ MPp|0S` 0|0P U0 {P30C Sd7,5,5,5,5646d6,5,5,5H60S" Ѝ RPfPEUp {P  {P U l {PB00Uw U8 {P3Sd Sb 嬵00!ZP  R*00 Ѝ!LP !EP R <P@t;{PH `6{P P1{P ,,{P ,'{P "{P 0US0IS0DS0S {Pr Pj+00gO00c0+S =00XN00T0 P@&  % & p& t& (& P& 8& 0& @& H& X& `& h& & & 0R  & & 8@-1@0 3S8@P63?o208-M000 0 0Ѝp@-`P@P0S 010SppA-@ ]`pP$XT0U  HP00`3/03/V03 5 & 0@-@:^ M~P Ѝ0#0|P0S03 3S3 1S qC& 8@-0@P0$3/P 1 !S 2ST 1S Dv8I<60<688D018@覢 $ & O-LMC0TT00- x3`S6~ , 00 @P ,Pu9 U 30C Sz=<<=\<<<<==|=4=$=<3S3,/C@LЍ z*U OUPU LЍOUO  CP S40@P40S SC3S< P7OUL 2S  T@P*U} OUD 2@T OU POU P+U<@&ݘ@@@ @ 0COUP03*U& 0 㱘03NP@*U OU, H岳C@P8}2S x!R#RS 垳@P{L5] P{SS 0{SS{S 3@勳03P Q S 0333#$Pe03mP  mr0P03  0cr0P] S0  YrP{0#SU03s 0 S S 0CSYIXz  0 S S   0CS00S= Y $ P $0Y3i XF #30 1S03: 1S !R PP03*4C303"jH  P03QfO5<S0 U00Q [ <RcQT 003/PM  q3  303C 5 * ' * * x' \* * * * * <* '  6Y 0@-@16 Q R T0\ 0HFP03R (0Q  :  + + 0@-@160 0<S%P 03+ + 8@-3S @6^M#R?o20S88Q8@-@3S 16^S H003/8,, P 036^ ) 68@-P0@ S S0 S S q 0r S S 0CS00 SRd@800@830@-@S M03 Ѝ0_P  0P R # ϪC& @-9AM<@M0S 0< 0 P   :>AލЍ+ 0A-`QMUC P Q@ \q0103/000Ѝ"R,"R) #R&  R<&0$0p03/X 00 0ᵩ@P0S 0c|spx3t 03@lpЍ\0`p03/<003/@ᲊp= 2/ V* T* 0R6   ) ) 8@-1@0 3S8@P623?o208-M000 0 07Ѝp@-`P@P0S 010SppRA-@"Pp`p00 @Kt@T 00@Kt@T 00@Kt@T 0 SW@@ -S  o|P00CTT0@@0!@-R@ "Rd!R TکH003/PI<60<6D !@* + #O-,M0RTq 0> x3@S6n 0kPK3 S PU UV 0C S dhggfhfg0ggfhh0S 03,Ѝ0C S lgg8ihfg0ggfkkU,Ѝ0EcS1&  R K d0EcS dc7,Ѝ0 0 p0QE` cPaUU]  I8,Ѝ S$0P$0S S㘳40EcS 1 U o0EUcSN2Sx1S 03L#P030EcS  zU803[3So PFj3U  7bUcP2S0 U Q 0S0 62S  Tר@E0@SU^SZ 2Sy x!Rv#RSq 忨@-G* 0n0P03  0n0P03 S nP [03 0 S SPP 0CSPU~\  0 S S 0CS00S P U$ P $0U3 e \ 8`ncC 0 00 y0U 0L f<F 4I703333#P038  5 <P&4PPP P 0!S P 03pT P03L PP, )<, , , + bx, x' `' 4' ,, 4, ' `, , p, A-`D!D1@@@#3A c6^$(0 #  S R( 0S) =SP 0  =SS;S00S @0;SS P0 ;R@ aJ0@S P03AGed@wl+ X' G-P ` MQ1  0P@ Ѝ@ 0p 0i 0~ 0g@2#S00002 R00S1 Q 0<STTpWn QB 3S? 0So 2 03/Yz 3So 0<&R0iL&P 6 0@4P@P0S 010S2ЍhQ@03/0 3/Ѝ3S' 0<&R0!L &P 6 0@䀟03/ 03/0 3/T03 _@6  @XnP0P03/pz6P 0@(0@03/ + , X , , , , O-M90tq[' "R$  Y `mP㴡 @R" P@ T> 0S RR000R 0" Rf#00/ 0 0 / 1 L1 p@-0@PP`fPD@P.fP@ppO-0Tq)M  h0P S? zp% P P00 9j2QPP! PP R( bYw 0 PP0 `P *\ЍŞP P ZP:U?9P6S \P{1S0S1S ,0DT $x@}1S D1SY0S 603/,@0 ! 1Ti0T1, 041S {8B@1S 95SoPc $0yPR\Ѝ@DPRF0@ S2Sb 0Qn0&0 &0P 0 S S00 0  @P 0$S   P 0$S   P%  dP PR@D(0@H ako᫲Pt  ԏ3 2/[ #8P 00p 0ᘝ8\ЍX0P# cp3 T 帝 P ` tt#P d嫝I080 ` 8#P $L 0dP0601卝l203/e兝, 04`3SJ I )`P>0 3/ȏZL2 R` 6S? , 04 P `v,1 $03/@0B5 O@A65S 00;80S8 P 0 e090P  S`P0 fp4 P P) 0!P   H>,@Tjh0T10S 1S 01 !P0e! R?R!0 0!1 2 2 5 o  2 2 <2 ; 2 3 $4 2  < ` 0 \2 3  0 3 3 2 2 2 T4 L3 h3 4 (3 1S 1S/@-lM@`P` qc0 a!0q@P lЍ003/B p@-P@@`0 孺TPp(* R0@-P M SPS06@T Sc 000  \00P3/ Ѝ0SPS   ( @ @5 45 4 A-P@%b`pP &cQQ00 0T EP QQ0  O-Mcp c0`0PP3/@P!  6b0 0 0.b 00  &b80 0 0" 400P3/Ѝ80@@Ѝ A-MP`pb@P L0L03/P00Ѝp 0 Ѝ \' 0@-=\\ L^ =\\=Q 0"\\ P,\ \\U@ P\ TN "\ \ \0P @ PP@ P 5HƟO-@`pMt$ 0\V0 >bP 0=S  PP "@ @@0P503/=ߍ.0@,00.@0PP "00.|@0P \03/X aPL503/P? ,R ,R R 0 3/,Q1 @ QP PP 0,S0,S S 03/ @P0!`$PL -@P ax -$ -a{x - -apx  -@ -,@P @ , ,a[x@pP ,l ,}aMx ,@,P@@(#0䱸 TH.EPP ,@P 0`a0x0┰@ , ,Sa#x ,@,t@@"0䇸 Td,@P P ,L ,5ax⸰ , ,$(aw$ , ,aw , , aw  {, w,t s,@w,@@\!0> T00$0(0 0.0(ʽ0p3/WP- P20 L2% 0@3/0,R 0R@ PP PP @03/@ 6 ,6 5 `5 h5 p5 |5 5 5 J (* H5 5 5 O-M@  ^0 0\pP` 0 gpP c +03/ T 0S  TpP 7PW  +03/x Q  0xT$4pWh  +03/ 00S  "S\S0S203/pPN 0S \"S\S0  00S00 Q0  0,(PPd03/U聟  Rf 0p3/W  R\ ּ0@3/T 0@_ 00ЍLT pP  +03/ Td[ 0!!_000  P000& 叼03/p< 00 0Tx0H 值pJp@P0sPR<6  5 l6 6 5 7 07 5 H6 6 p@-@p`P03/0P3/0P3/0P3/0P3/P03/P P PPp O-M M0`0@pPU E_P00  @@PUB/0P P 303/3B03/P0 @PU _ @@PU 00 ,U @P BP00 0P 203/2B03/P܍ ЍP |203/p2B03/P`PC P @03/0d3/P2b@BD$P 0 0%D7 L7 T7 \7 d7 5 5 h7 t7 7 /G-ᤐ0p P`@T ]P Z@T &^0  -S_S  0`S``a|4 7 R/0@-`S00 0 Mp`P@P 0 0 Ѝ 0P  R 0 0 0    00000/1S 0 020/O-@ $M  P  $10 S  0 R013 S.1Sr`03/$Ѝ( 00 r00 3/`PP0 000P  0,`Vj r  ,\ <R0#3S  ౟ ,1S R  -#R* 㤱 0R0-3S*t`  0@@ <` 0R03S @0 ذ`  0a㸰`0 $!00똰` Rq 0 pWl  0] W(p0%c*0`3/`0 [7 7 7 7 7 7 7 O-dMXP<DHL$ HP P C  dЍp@`X񟗺 8\TQC dЍ 00#0 0\PX =X0@03/<P03/PdЍ00L0 $!0<0Pԓ < L0P㰓$< L0P㌓ 0 0@3/@r\0D0H0P` 0=S] DH +P 0D3/P0 0@3/0P $<303/203/ ߍ "*P(0 F@7 0 E @ /o"$PU  Rk $0S(0Q ,QG L P+ pW@ @PE,00Q0 0P    @ i/o"  XR0P pS R @ K/o"h 0S   00s 003/ߍg[e$0S  0P[`V  0PQX"BL00@3/8003/ $00ߍ: : ; : ; 5 ,; \; ; ; ;  ; ; ; A-M(M00P`  0P pW 00CS @ 6/T pW Jڍ(Ѝp $6/P P (*(@ T P zQ ,ڍ(ЍQ00  0/C-\2 @0p0CS$PPP  00`\P 0S ea0 ^  7P0  5P 0S  - /@-P<P` @0Sp` @d`p03/< @0q@S<03/0<0@00H@3/0H@3/@ <0@-@!06 R P 0#9  5 <* x1@-@S6 0 P03 P 03= D @-`Q0@6^33S  sP"03%P3SPp 0p9&P &03/03`03/0c3/cQpDd( ᔉ0cc1 ) = 8@-@P6k3?o2086@- 1l@l@0hP !CÀ 6~@`03I3?o20@wO-P@M*`AVQ+P`I!+ SR/ VDR R0!0)  I I6P03Ѝ  0"$Ѝ?Ѝ6#P 03Ѝ!` 0`` ``܈0 0cЍvR 0I= = P= T = ,= |= p@-PAT@1S@018 1 6,`P0C3媈p@< = O-M`Pᆌ1Pp0 G QRJHQM L1/Pe P 姈ЍR1!Q6#GP!03Ѝ 0PGP t6pƙ > > 0> > @- @NP  NO-M MP0` P0N s PW NP6-P/03/PP 0[S :S :NP{ $ MPu  gNp:N@P  N\e-NP  NQeZ  0SY(@0D DT0NPTZ>00C P0 5 OY꤀,h1S1S01QV T0T.$ ~oP :RE S SQ'R  RPXSq R 0X !3ލ Ѝ PMP pL0@妢|4 00Z@P :P(@  0Di Qj p iWe 4^0P3/09% 0RP NpWb 9 $(M 0 Z W:P 0D0T%44Q%4D40$MPj M cQ00S QbQPrP U8 ca 0 0T$ 00N PP a #Rލ Ѝ| \203/ލ Ѝ]M0P  apM ӆRIMa 1N`a 0 ẆQ0P0$ D0MP wMMPP oMca8 i? 0 ,0.Q0R Q~0P0 .4P x 06 -@PP &a vQSS00A6 @P a aQ 0#3S PP  > > T> p> d? > 8? Q< @? ? L< ? p@-MA`0T` @zfP *PPPЍpm fTЍp`A-@XQM p`pJMP FQЍ pOLp7Qw ޅсXqac1 Se! 3/P Xq Q0X10*1 4ЍЍ? ? pC-@Q0MUa#!R P=>  Pź0 3p#Ѝp\垅Ѝp,&j0PP00 0 0㥺? @-@P  0@0/ O-M`cPy2!S<@ SS SX0S3) /0L0P 303/P [0 i0b0  0ۢ 30S03p Y 0S|2 #S 0 0S  P#` <0⻢PPW P0 Kb0 0c0Kb0P 203/Ѝ2S03/P8 dpPu /KP <6 0cSPӠS_oR YC ib e0㠳圓 {S 眳YD PjPUS031 03/PЍPU K0P/S0 S 0KP5 P 3S1S03/3#1S忄 Py 各03s0xS03/303?}P埄D嚄0 03/m \ @ 4@ @ C-@1`S 2S0!1SE  x103/PP% 9 <@&<JP( pp01AP2 DP20 $ap0 0A P rP>N 0 (IP D01CprX< `@ !0Q@-@! AcRSQ #R  P!  CP 0R 6P03@#R 6hP036LP09 # CK@ 5 * t@ |@ 0R 3S0T!2 S\1s0`  D00q -0/X1 0/6;R8@-P@WJ00 +r R 00 +r R 00 +r R 0 S  8 / OIa 8@-@QU L元8@_8 `3Q9,xU(P 3#038@ @ @ 3O-IM@p0pP`3/3sSUVc IߍS  dR IߍVP5S p(,0S 0 0   $0 JP0S 2S  ,!2R 810CSX2/P}  06481S0  0d尛Q !QP12S7e01(IP #0" p  !0IP)  (0d弘Q# 0ӂoe3VSwk0c,c 0(嚂! 0S4" R1#0S.0S.*X  6Q 8810CSX2/PH, #uqt卂9 0T儂00S:8| ( A TA A A 4A B (B Ў hA A A Qp@-A`I`Q P@,6 PpScp#p@'HB 0Q Q -QA I ^ 0 0 0"R82S #R @-@6P03PB A-@ RP!D:UDU2?Q S 60*S00 3PSÔSÄ \S  Q0SU U U 3S="3 BQ/o"#% #R" 36P( 2 2A 0S 6^p(`SR f(Ae3S 3 #6 tcP03Ao2S @#TP 03$#LP03 XB = > 0! Q"R"R @-@#R 26S -P  #PQ`#P03#6R ,P 0 Q pB B hB `B (& 01 0S 3S @- @6P03B 01 0S #R @-@6P03> QA- Q Q% Q@& A@P2S! QH T!0L壤`P; @ 64q0@3/03/T03 A A98!蓕弈R񟗚((((9AZ3 DP0 E Q  E   Q 006-Q0  oE 0R~ zY Zj 03 0&2SU3SR  ~PM63?o20E1S* 1S' 0` 0E01 0 P 4SC 04 P000 0P0 000 0    ~ 0S (P X0  P 0 0&x<ȃHD hD 0Qp@-@Ma  0S0103ЍpPP Xq I0X101 4Ѝp 0S 000 0 0F8@-@P6*3?o20PS88@O-0xcPdMV@`T0Ps04 4ϟ9 Zᤦ P@Z~ c0F StddPl44|l,dD4TT2S x1S"3RR 0#3#>!P03dЍedЍPZ}Z  1V. "R+!RІXXQO  0} 0}=>c2S 4P4`V~}0c3dЍ u}cdЍ b|=ZZ 3S2S@Z Z  4z}ZP!032Sz 043rP4`VA}03 }Z  U}TuȠJcZSUe QfpG}gV` 001 l&l᜙ 0|P ІP0X000X 00S$ d 0g{V  {  0l` s{M{V  "R 09{yWv/{QhoSL&{0 P&3cU` :{@4Z VNV4PKP4 0!E|P C`#P 03; UyAV)0 QP ] P  $ 0!|P h#P X 0_ 0#R#1C!|P03 0z&P4 #dŸ 0#3!Lu203/c@( $ 00"4ᣘ4;9 O@Pp@ hY W(X ;A i0GS S(X  ЦZ 000Z 00S  0Uz P103/Kz: dz0 3#wt9z0 &3u03/p0/S (!0PP03/ cz# 0&3W< ) tG G G B ND G @G ^F &hF XB E E E E E PE E D D F HF G F (G F   89 ?E E TG F G < = @L E (F I dE D HE  \@lPfO-0P0@#p3R ؕ`&R &,'(|'':P(P 0^ 0^ 0^ 0^ 036^Q! 000 P` `E P`6ӯ6P 0S99 && Rl06.6S` P 0P6`0 Tx눦iPw`03/0否3/6S0960S>X`0S 03/PP`0`03/Vp0P03/V63/VV@0`03/ᐖ63/᜖嘖`06N` L5H H \H 8H O-`DM`sP9 Z< NQN|-,,,,,,,,|-|-,|-|-,,,|-|-|-,,,|-,|-,,,,|-,,,,,|-,,,,,,,,,,,,,,,,,,,,,,,,,,|-,,,,,,,,,,,,,,|-@ #!\0 2/#0R 0aP P  >  >Q 0P P R㴓 #R Q 2/ 0( R @|4|03/0 3/#R TwXq T3SB0X101 4T 0S3S 0S2SE <&SR SR \ \ 00 03+ 0S%rW" `( X 0D*S @P W 0< 8PZ<0 SpWDЍDЍ0 QP 0 QPN <# 0QPD &QP@ 0<1w@ 0 #3/n&R0t"@PQXqo jp3Sv 0S1(∓ 3PW 04 0M00刓PSQ P3SA4 RR[ `v@k3Sh"000P 00S\ v@W0㭓崓1XT@q%K 0v@CxQ v 0X#1 va&R0lv01VTv 01#M 5 H  |I H ` I I DI H I H H -A-AMMC΍ 0,$P 0A~0`' @00T @c`Tp 0uP 2S 0P v0TAލЍA Ѝ/; (0@-H03/@P H 3= Q/p@-@ P<03/ 0< p@/  8@-P6@Q 0 P08@-@V<f0$ \ p p,0p\ p p0(p(p 0\ S p34S, 0 $p3/P0S  Ϭ`P0`4P ,;P  00T`I 040/ 0@-@03/00 /O-Ɍ&M@ R R  RQ} ((p`0Z <D D@D AP~* Rm Rh R^T99x8,8 RX [<  <0 0rS< -S40wP0 -P4xP@0 sP!= SP; -P4rP 0 -P4wP0 -P4xP sP SP; -P4rP0 -P4wP0 -P4 xR tR TR< -R44 8 0080,`UЍЍ RP::x=<L<< =P== : <2/P @ < @ u 0 B R  [ RH P:R [0  Pf R> R [< A<  :Py  80 @080   Q  Q [9  ;P00S0% h ;P [ D0` 0CU0  x`P 03/ <<Qn @  S [ 0 Y RU9@t@T@(@??|? R RH [  [A<P < ;Pb$;  -KF[ SA4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<A4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<4<A@@4<4<4<4<4<4<4<@4<4<4<@4<4<@ RM R [   0K [0W RI R [  <0 0  C0   0 R1 R [  <0 0  C0   $0 R  R [   :닰00  R񟗉X?8??>>H>  R # L~:Py R  :Rr [<  B   0wP_ 0d^  R~D O [   7:0 0D.[:[A k0 [00; (:닰00` 0020 [00e :0 010#.[[" L0 [00 :닰00A 000 [0000 [ 9닰 - [+<  B0 0 P00 [ 0 0 [< [ [   D0 0C0  [   [ [ 000>[00000-[000 [00 [ [   0 0             9닰00  [ 0K [  [  D [D<  B 00P t[ 000 `FD j [V [c< A  <000 ( C  LB0 JD  < D00C8D  AD 3;0 8 0SR P1SR790"SG 00s<0 < B0<  8 00S1@s08 8 0 00 0< B<0  8 00S P0 QP08 @ 8 0 00 0 0< B 0R(0 000<0 0  C0  0 J J I I I O-TM0H  @@ L(     >X? X@X=X$ ,X :X`; X<X9X$ ,\ 6X7 X8X5X$ ,` 2 X3X4X1X$ ,d . X/X-X0X( $h* X+X)X,X( $ l&X'X(P'd*@(X%X P P%Pp ́p\" X ,`#`Xp)J!X$X@( @ . `%|n@)t@ @@X ,`X pXXHǎ .D ` "@D x@ Xdy`X,pp!`XPX( $4I p  @p\ @'0@ P|PXX`XpX(dJP!  P  % $PX嬨'X$ PX`.X` Ƞ Č|xfe"pp XXp4HX |X&P X! @P $eZ')KL OD ! X X Dž @X X % ` " l``@,8`X X@@$pXXhlGt `@  lP @"<@`pXX4dJ !PX X  " x tpDŽ  $  "0p`V P  "V !P @" 8P뻁&@+ @@$ ,Plɋ|F ,@  p"pgv\V 'P  "$0@C[T{ ]T T 3t00 0 -T [T v3t   > @B\Ta ]T T(*@a3t   r R >0`PC@]Tt [T ?T*T ^T!T \T T > @`B:3t00 0  u    u   u000 |  0r T. s0B:P. uPTB0*@p@kk3@  Y ]T* \T@00 O >0Cp=@M\T?  < > @B@>V`@m6@>01SSe 1S#@2@:Tk``@    Z Vn]R1P |1Pa/ h1Pa) T1Pa# @1Pa ,1Pa 1P 1P 1P 1P@`V >@D@1S1SA ]20 0;s0!R?o2Sx@P!R>@`DC20 00s0`  P ` :R @}IߍIߍP00  >0`@C1S 1S 20 0:s0Sh3 20 0;s01S 20 09s01S 10 0:s0a1S 10 0<s01S 10 0<s01S T T00z1S 10 09s0p1SJ PJ XJ `J hJ pJ xJ J J J RQ/p M CNS F~DF Fr J KzD"R FXh Mp@pG4^0Mbc(2OtgDD%F٠#DhF! pG!hFD?!DBnFD5t$Bt## 0F!+ЌB##B##Fp F#M}DF8F4`#``#acaaa#bcbbbc#dcdee`F0F `H2F9Fd KXh`fK!H"XxDh 3KO{DDhnGFJ!KzD`X,h\ h+h Fn+` ,h,K IXyDhG0FF 832 t8ML}D|D+h#hG0 8M h IcYyDhG8@K *hIXyDhhG8@ 2p8pNM~D}D3h3h:GCFpO0pL hI+YyDhGO0pK 2h IXyDhhGs Fp~ p2T8ML}D|D+h#iG0 8M h IcYyDhG8@MK *hIXyDhhG8@@ 2@pNM~D}D3h3Zi:GCFpO0pL hI+YyDhGO0pK 2h IXyDhhG Fp 1(pNM~D}D3h3i:GCFpO0pL hI+YyDhGO0pK 2h IXyDhhG FpF 81pNM~D}D3h3j:GCFpO0pL hI+YyDhGO0pK 2h IXyDhhG Fp 0pNM~D}D3h3Zj:GCFpO0pL hI+YyDhGyO0pK 2h IXyDhhGk Fpn `0pNM~D}D3h3j:GCFpO0pL hI+YyDhGCO0pK 2h IXyDhhG5 Fp /npNM~D}D3h3j:GCFpO0pL hI+YyDhG O0pK 2h IXyDhhG Fp /RpNM~D}D3h3k_M_ '&o)F@)߀@"5'aOр@?"a?A@CF"!)F Fb(F9F(F9F(F*#0Ca*@C cE:.*xpfxpf#sCsB*G*@C@X+@n+x+@CS&1F F"#"` z*F! FjFEA F|jF FEACr F@pG#s*#@C@sB#s"+Ŀ $"8F)FDB8FvPF-M}DH!"#FxD ~HIxDyDF(ӀIJFyD FPIJF@FyD@F!(D#򆀊F!FF@F(ЊkKh(*[0hBqIBFyDF GsoM}DnM}DnH!"#FxD/[0BFiI yDhGgH!"#FxD[0 cIBFyDhGKOK `IO:[0yDhG1ILF[I [0yDhG&CK VIO:[0yDhG>K*FRI O:[0yDhG8KO:[0h\hHIyDF G/KF[0hJhAIyDF G'KO:[0h:h9IyDF GKO:[0h(h1IyDF GK .IO:[0yDhGkB@ 44&llDiPDT(Htxvr, P,T)HOr-OxDO1&L0%K|D%IDXyDD(F#Oa+h"JD"HD"IzD"MxDayD!J}DX`D`d||NDHDI~DMxDyD}D $(bc]dXefXZfʱ Gw7sK{DhS 0O0 pG> -AFF9JzDh+D+W+Y6JzDQ4JkzDC"2$.JOzDs c\P#@!@$@#@P#0K*FI XyDhG0FK{DS%P!@$A@#P#0UhO6 K*F I O6XyDhG:hĴ &b-O pFF F F"F000F*F N~DB F pK"FIXyDhhO0v𵋰 ^F $FFF)F8F2F M}DB F K"FIXyDhIJF@FyD@F!r(򆀉F!FF@F(ЉkKh(*[0h2rIBFyDF GtoM}DoM}DnH!"3FxD/[0BFjI yDhGhH!"3FxD[0 cIBFyDhGLOK"F`I O:[0yDhG1IMF[I"F [0yDhG&DK WIO:[0yDhG>K*FRI O:[0yDhG8KO:[0hJhII"FyDF G/KF[0h:hAIyDF G'KO:[0h(h:I"FyDF GKO:[0hh2I"FyDF GK .IO:[0yDhGl.  bJJ"֖f\,00r$obpVR ^b>6HOr-OxDO13L0̀2K|D2I3ODXyD2NDȐ(F~DQ+h/JDzD/MD/HD/I}DbxD.JyD_aabaYb4DDD&OD&ND&MD&H~D&I}DxDyD,0D<8@DddeXefXZf i C1QuUWe/(O0 pG-A0O1KDW0+LFF(:+LO !|DT%0D`#$.#j!l3X!CPK{DC%`!#j$l3X!PK IXyDhGO0K*FI XyDhGO0 K IXyDhGO0HZʨ PK{DjpG: Oa#jF$0@B̿ O0 $#jFOa@~(̿ O0 $#jFOa@f(̿ O0 #Oa$0P$# jFOa@: $# jFOa@& KL{D|DFjOA jFj$M}DB F KXhhTI2FyDF GO0 \ Z-C DSkOD8F!TNhKF1{D02Fbb(NF12F F(V[MF1 F}D*F(\F1*F F(dF1 F*F(kF1*F F( FqDODDKX0hXh@I:FyDF GO0;KX0hFh8I:FyDF GO02KX0h4h0I:FyDF GO0)KX0h"h(I:FyDF GO0 KX0hh I:FyDF GO0KX0hh|I:FyDF GO0KX0hhjI:FyDF GO0{vp [ <X-O;K$;M{D:K}D.{D9KD05{D8OD7KD{D + U4(݉ O3+`,V?+ F!*KXhO  ` IFS$@FZF<@F!݈nFxZF`FH`F@FKXhVhF G f-O x !x"HFL!x"PFH?H?IDxDyDF(f|@v2v|,H"-OO1xD*L)K|D)IXyDD(FU+h&JD&ID&HzD`yD%JxDY`Dd$OD$ND$MD$I~D$H}DyDcxDYeXd $bbMXHIeeYyDJe XffXZfp /Eq-0K1Jp{DzD0Nh~DR D3hh!DB#(5آ *)%&JzDrBQ_B JzDR **%lm@pKFI XyDhGO0pK IXyDhGO0pKFI XyDhGO0p KF I XyDhGO0pOr *J*KzD*N{D~DR hD3hh,DB#(l4"JzDrBSOBK{DS 0+ѫ@:h!" ;`C ;`KFI XyDhGO0KFI XyDhGO0 KF I XyDhGO0&N xK{DpG IyDqBS/B pGO0pGB8K@M!{D"}D2```2\h K"{D2h` 8 )H*I𵥰xDyD$%ODF(7Fx!(F0FJI(FyD(*ؿ$* + +̿$$M I}YyD-hG F%K IXyDhG % K IXyDhG %,*4L-O=K=O${D(N BIjrKL{D|DF ROA jF$M}DB F KXh\hI2FyDF GO0犒 G#( OFD0pDHxDP%0 +*pFFB,SOB:K{DS%0+G8N~DV%@bY F "V%@! F Fl:F!# 0CF F'K*F'I O4^0yDhG Fh<O4 FK IO4^0yDhG FK*FI O4^0yDhGKFI O4^0yDhG K*F I ^0yDhGB F$&R3H4IxDyD1ODF(P0NlF~D F@x!*F F1F"((F'I F"yDFP F<8#x, * *)Fp- * *I FyD(FI FyD@ EB(FK IO5XyDhG K IO5XyDhG>yv޲f`pFM}D(H!xD2F@q0( FpK IXyDhGO0p I KyDX"hGO0pI KyD@QKQO{DDhhh"DFBD4hhDB#($DR ^ ` .)l.%-e."~ZuEBU/B8JzDB D3hhDB*Ai<.HxDj@jF*i*7 3Q"lhSh61! @#S`! @ CS`KFI XyDhGO0i SOPpK IXyDhGO0 KF I XyDhGO0 E fЎ nD-O#(OFDxDP% +p FزB>S/B4"{DC% ,òx,r,,@فd~D+  x"FHFyDHF!`"FHFyDTHFyDF(ŁD!";FxD8F"4HF"FyDt(HFyDF(ʁ0FyDp( 0FyDh(I0FyD`(+I0FyDX(@{H!"#FxD FIHFyDxF( F,(Ix! F:F1F(8FO4KI2F [0yDhG F-  IRFyDHF HF!IRFHFyDIHFyD8F(4H!"#FxD< FIHFRFyDo8FK{DS%@cb+AI HFyD.F(!FFHF숱Kh([0hzIJFyDF G@FEA+Ŀ $"@F)FDB@F$D F-IRFHFyDK*FI O4[0yDhG F-H!"#FxD6HFI yDpHF!PK{D(C%򵀇F!FFHF(?|Kh(c[0h IJFyDF GiN~DN~DIRFyD:H!"#FxD[0JFI yDhGsN~DvH!"#FxDlfK |IO4[0yDhGxHyIxDyDJF(uIRFyD$ FrHrIxDyD8F(yoI"FyD8FU[0 jIJFyDhGIKFgI O4[0yDhGCK bIO4[0yDhG>K2F^I O4[0yDhG8KO4[0hhvTI*FyDF G/K[0hhfMIyDF G'KO4[0hhVFI*FyDF GuKO4[0hhD>I*FyDF GcK :IO4[0yDhGX >F6ttLuڱ&@n>?XJ>\&B||2*b-O8D P`+KD '{DK{D[8< +K<,D E[(,*[,H@&&D+3[ ,* [$H@&&D+![,*[L@؀&&D+[<+[,Q@̀&&DA[DLt x"A #$?F @F7TD D ZhKHLB}OAMD}D8Fi@ D"A #$V?Fڀ0FDDAlb8FiÀ "A #&0?F FFDA.b8F O@D#F"EBA+@ #C,@CF0F,DKK {DB%%D%%D%%D&%%D1[,,T/K(l2F &&[$,T,K l2F &&[,Q)Kl2F &&[+h)JD)HD)IDxDX`yD`X&J'M'HzD'I}DbxD&JyD`aXaa_dD#ND#MD#H~D#I}D#OxDyD$D(,<@_eeeffXZf ^*acws 7WiKK{DS 0O0 pG^ K" I{DyDS 0 h[ @XB pGB K{DS 0[ I J!@ zDh#YdpGJ!@ zDh#dpG@ , JpzDFR R K%@{Dh"aUbcd K {DpY`pG K @{Dh"aPbPcd Ԅ K{D@lpG Oa#jF$0@B̿ O0 $#jFOa@~(̿ O0 $#jFOa@f(̿ O0 #Oa$0P$# jFOa@: $# jFOa@& KL{D|DFlOA jFXl$M}DB F KXhhTI2FyDF GO0玃 r8 2-C DSkOD8F!TNhKF1{DT2F\dd(NF12F F(V[MF1 F}D*F(\F1*F F(dF1 F*F(kF1*F F( FqDODDKX0hXh@I:FyDF GO0;KX0hFh8I:FyDF GO02KX0h4h0I:FyDF GO0)KX0h"h(I:FyDF GO0 KX0hh I:FyDF GO0KX0hh|I:FyDF GO0KX0hhjI:FyDF GO0{ 7t -O;K$;N{D:K~D:M{D:K}D{DDD8KD{D +U4(݇ O3+`,.V?+ F!Z$p  IFXF:FHXF!( @F݆|Fر:F`FT`FXFK{DhOQ KXhVhF G$ @5d -A#FF0$DF(@,KO{D#D[h+,)M}D%Dlhb> F "# 01F2Fhhj:F!CF Fh<O4 FKBFI O4^0yDhGKBFI O4^0yDhGKBF I ^0yDhG 4n,H-I-AxDyD*K{DF(@(NlF(O ~DD F9F"x!*F F1F" F(!F F9F"(@F!F(FZI"F@FyDI FyD4@ @Bx J IXyDhGO0 |eR!MFN}D~D(F:F@qd( FKXh8hI*FyDF GO0 KXh(hI*FyDF GO0HA0xDM}D(# OQ#"K{D`CF$ F0 K IO4XyDhGK IXyDhG@V~} -O# FFȳDF(@nK-{DF DOZ`K-)-)-@NM}DK I{D@FyDS$JF\@F!<ЀNJFI@F~DyDL@F1FF(LHcF!"xD`FIJF@FyD01F@FjF(dI(FyD0(I(FyD((؀I(FyD (I(FyD(@H!"3FxDP0FI@FyD8F( Fȹx! F2F`)F(0FO:KI*F [0yDhGPF-0FLx|DDehkYЧIJF@FyD"F!FF@F뀱Kh({[0hpIBFyDF G8FEA+Ŀ $"8F)FDB8F:PF-H!"3FxDHIxDyDF(ȀIJFyD0FIJF@FyDl@F!L(``}ۆF!FF@F(ІiKh(-[0hoIBFyDF GzlM}DlM}DkH!"3FxD6[0BFgI yDhGeH!"3FxDv%bM}D[0 `IBFyDhGOLK ]IO:[0yDhG6FK"FXI O:[0yDhG*@K*FSI O:[0yDhG:KO:[0h.hJI"FyDF G 1KF[0hhBIyDF G)KO:[0h h;I"FyDF G KO:[0hhz3I"FyDF GKO:[0hhh+IyDF G} qvĠp ̠b0؟&:6Z\(VV2-H"-OxDO1+L0*K|D*IDXyDD(F(O2+h'JD'ID'HzD`yD&JxDY`Dd$ND$MD$I~D$H}DyDcxDYeXd $bbMXHIeeYyDJe XffXZfx H-|Y9MqK/q ?( K{DhS 0O0 pGO0pGw -AF$N$O~DD\h,&шFp5?3hS%0 J@zDD@0A#@J@zD\A#@KFI XyDhGO0 K*F I XyDhGO0w 64tp FFK{D5?IKyD{D ht`R% D 0, p@!T"!D"0pP!@@U"0# CE"@pL*FI YyDhGO0plv K{DpGvv Oa#jF$0@NB̿ O0 $#jFOa@6(̿ O0 $#jFOa@(̿ O0 #Oa$0$# jFOa@ $# jFOa@ KL{D|DFPOA jF$M}DB F KXhh I2FyDF GO0Vu *x-C DUlOD8F! PiKF1{D2F@Pr(NF12F Fh(V[MF1 F}D*F\(\F1*F FR(dF1 F*FH(kF1*F F>( FqDODDKX0h h@I:FyDF GO0;KX0hhx8I:FyDF GO02KX0hhf0I:FyDF GO0)KX0hhT(I:FyDF GO0 KX0hhB I:FyDF GO0KX0hh0I:FyDF GO0KX0hhI:FyDF GO0{$t *RDl-O8K${D7KD7M{D6K}Dؐ{D5KD5N{D5K~D{D *U(ۆO2*`4 ,+Z/* F!~2hIFO8FR$ 8F!0Fȱ2hR XF8FK{DOQ JX hF GJr V(82fr *r -A#FF0DF(@,KO{D#D[h+,)M}D%Dlhb> F "# 01F2Fhh$:F!CF Fh<O4 FKBFI O4^0yDhGKBFI O4^0yDhGKBF I ^0yDhGq .'Z HI-CxDyDpDF(态NlFO ~DD F9F"︱x!*F F1F" F(!F F9F"(HF!F~(FZlIHF2FyD@jI0FyD(pgK{Dap0FycHdIxDyDF(`OD Fd@x!*F FD9F"((FnXI F"yDRF(g F8#"\ * *(Fp- * *%x-@Ѕh_-;20 F(I8@IDyD F(5=I FyD( &&:K0F{Day7I0FyDt(<4J!4KFzD {D0FyPh,K ,IX0yDhGo&&K 'IX0yDhGd"K $IX0yDhG[K IO6X0yDhGPO6MK IX0yDhGDV&b%غJVj@|t%ZLo $ZF"M}D(&( N~D0F! :F@qF( FN~DKXhhI2FyDF GO0K IXyDhGO0 KXhh| I2FyDF GO0NL` Z0f5M}D(54K{D0+;2K3J{DzDCq B` /HAxDh-+L OQ|D#"C$K{DCF$% F0K J{DzDqr` KO|R{D#KO4Xhh IyDF GKXh|hIyDF Gm m &#"Jm 0m ""pFMN}D~D[h++G4?*h!KR$ {DD0P#0BF pKFI XyDhGO0pK"F I XyDhGO0pl X-O# FFDF(@t,Z,8,8,@]M}DL I|D@FyD#hS* @F!ـN@FK~DI{DyDF3hS* !F@FF(QH#F!"xD F$3hI@FyDS* v@FF(tI(FyDt(I(FyDl(I(FyDd(I(FyD\(@H!"#FxD FI@FyD|F(, F2x! F2F)F(0FO9IK*FyD [0hG8FHF-MO0F}D%Dnhs\ЮK"I@F{DDyDhb`S* \FV!FF@F"뀱0Kh({[0hIBFyDF G8FEA>+Ŀ $"8F)FDBܭH!"#FxD}HIxDyDF(ր#hIS* yD0FVK@FI{DyDhS* @F!(h`|ۅF)FF@F(ЅnKh(-[0hHuIBFyDF GsrM}DrM}DqH!"#FxD+[0BFmI yDhGkH!"#FxDhM}D[0 fIBFyDhGHQK cIO9[0yDhG.KKRF^I O9[0yDhG"ZI*FDK yDO9AKO9[0hlhRIRFyDF G8F7KF[0hXhIIyDF G8F-KO9[0hDh@IRFyDF G8F#KO9[0h0h6IRFyDF G8FKO9[0hh-IRFyDF GN_k k TJ<&_~~V Q& xj T8T)i 6΋Ћ̾:6 N-H"-OxDO1+L0*K|D*IDXyDD(F(O`+h'JD'ID'HzD`yD&JxDY`Dd$ND$MD$I~D$H}DyDcxDYeXd $bbMXHIeeYyDJe XffXZfXg mtAa]3] Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/PUQ @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/!1#0@-@P40y JZtPe@ 0!"# 0!6U0Ơ! p6#6 r04W @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rU*\0@D1?o 0 0C S  b 1 b0@T0@@T @@ d010 @d d001046#!@PE 40 010ʰ#0E208Q00 FV100/0@-K2@P0/0@-K2@Q`B a43!/23/0@-MQ /0@-P /0@-QZpK2@!˰\    ! 0bà01@OSRQPM`-4Ѝ /SRQPM`-4Ѝ /@- A{J@-!p A k [k'kFKE{{:/=A@-@`pP5%  V00 @-p@P`_'a& T00 QO-p`pp`S r0 \^ @P4Qoo pV?o 0?opc vVT33:@T PhW h UT:@T P@P@P@PpW`p I NVZpSRC-@P7Soooo `Qo o`a 4pUT33:@T P&Vh UT:@T P@P@P@P`V  X 0R b0A1Q A1/ 0R bAQ0A/C-pH`HP`P`eFa@@0 3/T/@-dbgDrvSleepdbgSchedualPostdbgSchedualTimeTestSceneTaskdbgDrvStartdbgDrvWriteCmdSchdCbTestdbg_drvUpdIotParaSchdCbTest2DrvTestTaskdbgIotQuerydbgIotUnlinkdbgWriteFiledbgWriteFileXdbgUpdateAttrdbgDbgDispPwMasterdbgIotkBlkSizedbgIotkQueryInitTestSceneTaskdbgIotkTestScenedbgIotkSendGetCnfgdbgXRGBtoHSVdbgXHSVtoRGBdbgRGBtoHSVdbgHSVtoRGBdbgRGBtoHSLdbgHSLtoRGBdbgFeibitBdbgInfo1_dbgShortCutvolk_messagedbgDispDevDefaultmainTestFeibitDrvSleep:%did:%d, serial:%d Version:[%s] 0.0.64 Cmd:[%s], arg_num:[%d], Comment:[%s] arg_num:%d /root/iotm/test_cmd/%s.txt127.0.0.1300_1_B1001001_7ip:%s, port:%d, id:%s, blk_size:%d, len:%d file err:%s /root/iotm/test_cmd/test_scene1.txt/root/iotm/test_cmd/test_scene2.txtdata: %s{"action":"RqIotModify","serial":"%d","me":"300_1_B1001001_2","pw":"%s","data":{"del_files":[{"file":"%s"}]}}{"action":"deviceRelease","data":{}}Time:%s ************** test_driverfinishtest data....finish:%shms (%d) DbgModelId=%dDbgModelId offkill:%symdhms timeout(%d)(arg:%s) Check By IptableDon't CheckCheckIndoorOnLine:%srecv cmd:%d, data_p:%srecv sleep:%drecv sleep:%d finishrecv cmd:%dfile is scene file.{"action":"linkStateQuery","data":{"ID":"%s","ModelID":"%d","ModelSubID":"%d"}}file is not exist.{"action":"unlinkNetwork","data":{"ID":"%s","ModelID":"%d","ModelSubID":"%d"}}RqIotTest300_1_B1001001_2parafdRqIotWjson %s invalid cmdfile num is not exist.upd file(%d) [%s] = [%s]lumexpw:%s/var/iot/zllGateway.binzllGateway.bin:%d ping result:%d result(%d) %s %s 300_1_B1001003_1AaScene Log:[%s] sendarg num err successTestSceneInterval:%dstop{"action": "RqIotTest","serial": "1189096065","me": "300_1_B1001001_2","pw": "0000","data": {"file": "0"}}Remember turn on flag:[dbg volk 1]file_num:%d is not exist. r(%f),g(%f),b(%f) -> h(%f),s(%f),v(%f)h(%f),s(%f),v(%f) -> r(%f),g(%f),b(%f)r(%d),g(%d),b(%d) -> h(%d),s(%d),v(%d)h(%d),s(%d),v(%d) -> r(%d),g(%d),b(%d)r(%d),g(%d),b(%d) -> h(%d),s(%d),l(%d)X h(%d),s(%d),l(%d)h(%d),s(%d),l(%d) -> r(%d),g(%d),b(%d)exec:%d times5051exec=nowTEST PACKET........abcSend:[%s]cmd_data:[%s]Save As:[%s]Content-Type: application/json;charset=utf-8http://1591bf9371.iok.la%spath: %s BCCS_SDK/3.0http errorhttp response: %s display model_id:%d, model_subid:%d display model_id:%d, model_subid:%d, devid:%s {"action": "GetSecurity","serial": "1189096065","me": "300_1_B1001001_2","pw": "0000","data": {}}{"action": "SetSecurity","serial": "1189096065","me": "300_1_B1001001_2","pw": "0000","data":%s}{"action": "%s","serial": "1189096065","me": "300_1_B1001001_2","pw": "0000","data": {}}ArmIndoorArmOutdoorArmSleepDisArmfilename:%s, full:%s: %s 20190227-181354[IOTM_CNFG] time=%s version=%s sys_log=%d log_server=%s iotf_ver=%d dbgk=%d test_indoor_ip=invalid test_indoor_ip=%s write iotm.iniiotm.ini%s=%d Invalid ip addr. SysLogActive:%d, SysLogServerIp:%s 192.168.0.172192.168.0.156A1001001iotkernel.iniini fail7_VDPSetIotKIPMiniCmsIPGroupIDSubIDini okIotkIp:%s, MiniCmsIp:%s, GroupId:%s, GroupSubId:%d ./iotm.iniIOTM_CNFGversioniotf_ver%s = %d dbgktest_indoor_ipinvalidsys_loglog_serverver or time is diff(%s,%s),(%s,%s) ver and time is the same%s/%siotm_datmaking iot dir:%s iot dir exist:%s making dev dir:%s dev dir exist:%s iotm_sysmaking sys dir:%s sys dir exist:%s Fork Failedchild process. keep continue.child process. keep continue. i am parent process. child's pid is [%d]. cnt:%d Child(%d) Complete. status:(%X) parent:fatal error(cnt:%d) Child is okChild is ok /bin/ip addrFailed to run command192.168.176.253***** add ip %s *****ip addr add %s/24 dev eth0/var/run/iotm.pid192.168.0.241--- IOTM MAIN PROGRAM START() --- --- IOTM MAIN PROGRAM START() ---IOT-M Start:(%d,%d,%d) prevIOT-M Exit 192.168.0.255GETIP Feibit:[%s] Feibit error ABCD TESTcompress(%d,%d) uncompress(%d,%d)[%s] DbgLvl activeDbgLvl deactiveinput datafgwdisp feibit serversch_prnprint total schedual tasksch_dschedual test(delay ms):[sch_d msg 1000] delay 1000ms once/repeatsch_tschedual test(time):[sch_t msg 8 9 10] send msg at 08:09:10 1000000sch_rmremove schedual task:[sch_rm 0 1334568]sch_rmiremove schedual task:[sch_rmi 0 ]sedispserdsewrdwdidfdelete scene file, arg0:pw, arg1:file numsfsend to test filewfwf [pw][fn][cnfg/oo/oop/lock/dm/color]w [fn][oo/oop/lock/dm/color]zupdudp [filenum] [tag] [val]killkill zllGetewayzllexec zllGetewaychkffile exist or not.pingsend [get iot cnfg file]iptdisplay iptablepw_mpw of indoor masteronlinesend msg if vdp online. 1:check, 0:always send.dbgdbg str_tcp_frag 1/0dbgfwhich debug flag is activedbghdebug helpSave dbg msg to diskdrvupddebug drvUpdIotPara()queryiot device query commandunlinkiot device unlink commandsearchiot device deviceRelease commandcrstart can error recordcddisp can error recordctrlbdisp control board verbosectrlpairpair iotm and control boardverbdisp attr verboseiotfdisp all iotm filesr1wdtscanscan new can deviceget current timehelp{"delay":"60","buzr_off":"30","zone":[{"index":"0","zone_type":"deploy","zone_act":"norm","file":"4","file_serial":"250061","cond":{"oo":"on"}},{"index":"1","zone_type":"24hr","zone_act":"norm","file":"5","file_serial":"161435","cond":{"oo":"on"}},{"index":"2","zone_type":"deploy","zone_act":"norm","file":"6","file_serial":"205908","cond":{"oo":"on"}}],"buzr":[{"file":"3","file_serial":"114091"}],"zone_indoor":["2","0"],"zone_outdoor":["0","1","2"],"zone_sleep":["0","2"],"act_panic":[],"act_alarm":[{"file":"3","file_serial":"230494","para":{"oo":"on"}}],"act_mute":[{"photo":"cam_no"}],"act_disarm":[{"buzr":"off"}]}AlarmNotifyTaskReadIotmTcpEncryptSchdStartRecvCmdExtractUartDevGetIp_RS485GetIp_RS232DownLoadIptableCheckIptableValidateSetDbgMsgIotmUdpSearchNonBlockingNetTaskReadIotmTcpFragmentSendDataToVdpDeviceSendResponseParseIptableDownLoadOnlineInfocbGetOnlineMiniCmsTcpCmdIptableNotifyTaskcbIotmDataFilecbIotmDataFileTestcbIotmDataFilescbIotmDataNewFilescbIotmDataDelFilesModifyIotmFilescbGetExtCmdClrWdtClrWdt_execCheckWdt_execIotmCoreTaskGetIotmCoreQStartIotmCoreTaskGetIndoorMasterPwIndoorMasterDeployCtrlbAcceptTcpCmdCtrlServerTaskAttachTextCPCheckTextCPInitConnectionstart**** CREATE ERROR ****error:%d**** RECV ERROR ****json: %sinit errorjson: %s actiondataalarmNoalarmNo(%d)socket failedbind failed Server is ready to receive !!Can strike Cntrl-c to stop Server >>could not read datagram!!Received data form %s : %d RespMeI am here.%sindoor(binary)indoor(data size error) ----- Start Receive Command ----- Create Feibit Gateway.ZigbeeGatewayiot_pwsys_pw.jsoniot_pw is too long:%sadminserialresult无#-100@RS485(本机)-%dRS485(本机)-%d#%doption:%sRS485(远程)-%dRS485(远程)-%d#%doption all:[%s]RS232(远程)-%dRS232(远程)-%d#%d iotRs485Info.count:%d iotRs232Info.count:%d name:%s, port:%d /Common/DMZ/Device/DownloadFile.ashx?option=ipTableupdateiptable from cms: %sIpt:%d %d [%s] [%s](Ignore Scene)Ipt:%d %d [%s] [%s]truefalseresp(0)%d. %s resp(1){"success":%s,"data":"%s"}init startMissing token:[action]Missing token:[data]iotmSearchdevIpiotmIdiotmSubIdiotm_id:%s, iotm_subid:%d, GroupId:%s, GroupSubId:%d{"action":"iotmSearchResp","data":{"iotmIp":"%s","iotmId":"%s","iotmSubId":"%d"}}iotmSyncIdReject [iotmSyncId] from:%smodel_idmodel_subiddevMacdevSnsynciotmSyncId from:%s{"action":"iotmSyncIdResp","data":{"iotmIp":"%s","iotmId":"%s","iotmSubId":"%d"}}**** SOCKET FAILED ******** BIND ERROR ****success(%04X) could not read datagram!! self_alive_check**** TASK ERROR(IOTM_UDP_PORT_TEXT xxx) ****iotk(binary)iotk(error)data_len error:%diotk(invalid command)[send] ip:%s, online:%d[skip] ip:%s, online:%dcellphoneall[send] ip:%s[send] ip:%s,id:%s,online:%d[skip] ip:%s,id:%s,online:%did:%sunicastdata: %s broadcastresponse %s ---- IptableIndoor ---- IptableIotm indoor:full_id:[%s] ip:[%s] isindoor:%d online:%d iot:%d %d [%s] [%s] iottable%d_%d_%s_%dindoor:full_id:[%s] ip:[%s] isindoor:%d statetableIptable is not exist/Common/DMZ/Device/DownloadFile.ashx?option=StateTableonline data from cms: %scbGetOnline(%d) getIOTConfigconfigNameIOTIDSystemIotInfoIotDataCustomizeDatacontentresponse jsonIOTID(%s) not found setIOTConfigdeviceRelease*** Receive [deviceRelease]. 1.Upd IPTABLE. 2.Validate File. 3.ScanCanDevice. ***iotm_ipt.jsonlinkNetworkModelIDModelSubIDpara:%s,%d,%dunlinkNetworkTrunOnTrunOffDeviceStoplinkStateQueryIOTDevicePairIptable Downloadfile_idx(%d),serial(%d) file_idx error:%d RqIotRPack(%s) as tiny Pack(%s) RpIotRprof裝置設定selfALIVE:%saction(%s)no memberRpIotWAddIotLogDelIotLogRqIotModifyaction(%s),SysProft Now(%d)RpIotModifybusyiot_busy:%djson(token num=%d): %sSetSecurityGetSecurity{"action":"GetSecurity","serial":"%d","me":"%s","result":"0","data":%s}new_filesdel_filesrenew online status for [%s]can't find [%s] in iptable[%s] send clr command.[%s] is clear.**** [%s] is dead. ******** Send WDT Clear To Outside. ****{"action":"write","data":[{"name":"watchdog","filename":"iotm","stat":"on","number":"0"}]}**** Send Nothing. ******** WDT EXIT PROGRAM ****START Read iptable from disk: %s Iptable is not exist. Reading it from cms.Rewrite IOT files(old:%d, new:%d).------ SysProft(%d), Last Date:%s ------ tcpqIotmCoreTask errorqIotmCoreTask q_num=%dqIot q_num=%d/fragment_task_queueThread stack size = %d bytes {"action":"getSecurityInfoCellPhone"}Missing SecurityPWD{"action":"execSecurityCellPhone","data":{"command":"%s","pwd":"%s","modelID":"329","modelSubID":"2","name":"%s"}}cmd: %s no response.{"success":"false"}{"success":"true"}GetCommandErr. [%d]netDevDeployspacenameindoor_pw error(%s)spacename:[%s] indoor_pw:[%s], pw_ctrlb:[%s]deploy success(%s)indoor master not found.data(len:%d): %scompr success error(%d): %snetDevFullListsel_listNOT FOUND Startsetsockopt errorset SO_LINGER error(listen)bind failedOk, socket_fd:%d, port:%d, ime:%dresp_buf size:%daccept error(%d)*** Select Error ***accept socket(%d), client ip(%s), port(%d)error socket(%d), nbytes:%dover TCP_RECV_BUF_UBport:%d, nbytes:%d, recv_size:%dport:%d, resp_buf size:%dclose socket(port:%d, %d), process next oneaction(%s). index(%d)waiting for iotLoadFileFinishinvalid format: %sprocess:[%s]permission is invalid: %s[%d] goto cb[%d] process this, resp[%s]warningno one process this: %sinit finishCurtainTaskSendSendCurtainCommandcmd:%d, data:[%s] para err.pause{"action":"SetCurtainOutput","data":{"oop":"%s","modeid":"%d","modesubid":"%d","port":"%s","baud":"%s","deviceid":"%s"}}Curtain: %s /curtain_queueTcpDriverTask_xiotMakeFileTmpRegFeibitIotDeviceiotUpdFileNameByIptCheckCmsOnlinesqlSelectDevicesqlDeleteAllDevicesqlUpdDeviceNotesqlUpdDevNameNotesqlUpdJsonOptionsqlUpdJsonOptionByNameRegIotDevice_RegIotFileToCmsRegIotDeviceDinUnRegIotDeviceitemSetStringUpdCtrlSelItemdrvAddDevFeibititemGroupDisplayWriteDriverCmdDriverWriteManagerTaskInitDriverTaskInitDriverWriteManagerSendWriteManagerdrv_Register_drvPostAltDatadrvUnlinkDevdrvDbgTurnOndrvDbgTurnOffdrvDbgTurnPausedrvDbgTurnQueryDispModelDefCmsUpdateContentByIptidMakeFullPath_xiotMakeFileiotMakeFileIfNotExist_drvModifyDinDev_zdrvAddCtrlb_MakeFileByDeviddrvAddAirConddrvAddCustomdrvAddDeviotPackCtrlFullListdevPrintModelAttrVerbose*** accept error ***start:%s{"resp":"success"}PDNXXXXUnknown_%d(V%d)_%s_接点(%d)%s(V%d)_%s_接点错误(%d)not definecreate error, [model_id]:%d, [model_subid]:%d%s_%04X_%02d{"action":"regIOTDevice","data":{"ID":"%s","ModelID":"%d","ModelSubID":"%d","SN":"%d","IP":"%s","Name":"%s","Note":"%s","State":"%s"}}11111reg_feibit:%s upd file(%d).[%s] -> [%s]src/dev_f.ciot_fileiot_activeiot_typeiot_nameiot_enable_file{"file":"%d","file_serial":"%d","name":"%s","fd":{"space_name":"%s"}}new_proftsys_proftlast_updatesysipt_idvalalt_tagSNNameNoteStatevendorCheck CMS...Check CMS(off line)Check CMS(success){"action":"execSQL","data":"select * from iot_system_device_tree WHERE code = 329 and id = '%s';"}cmd:[%s]resp:[%s]{"action":"execSQL","data":"DELETE FROM iot_system_device_tree WHERE code = 329 and subcode >= %d;"}{"action":"execSQL","data":"DELETE FROM iot_system_device_tree WHERE code = 322 and subcode >= 3 and subcode <= 20;"}{"action":"execSQL","data":"DELETE FROM iot_system_device_tree WHERE code = 324 and subcode >= 2;"}{"action":"execSQL","data":"DELETE FROM iot_system_device_tree WHERE code = 325 and subcode >= 2;"}{"action":"execSQL","data":"UPDATE iot_system_device_tree SET IpTableNote = '%s' WHERE id = '%s';"}{"action":"execSQL","data":"UPDATE iot_system_device_tree SET NickName = '%s' , IpTableNote = '%s' WHERE id = '%s';"}sqlcmd:[%s], resp:[%s] {"action":"execSQL","data":"UPDATE iot_system_device_tree SET NickName = '%s' WHERE id = '%s';"}{"action":"execSQL","data":"UPDATE iot_system_device_json SET content = '%s' WHERE objdesc = 'port_rs232';"}{"action":"execSQL","data":"UPDATE iot_system_device_json SET content = '%s' WHERE objdesc = 'port_rs485';"}{"action":"execSQL","data":"UPDATE iot_system_device_json SET content = '%s' WHERE objdesc = '%s';"}%s#%d******* buffer is overflow *******{"action":"execSQL","data":"UPDATE iot_system_device_json SET content = '%s' WHERE Name = '%s';"}reg:%s unregIOTDeviceunreg:%s string is too long![%s=%s]%.2f_subid_contact_devSnfile_serial_short_addr_end_pointmodel_id:%d, model_subid:%ddevice exist(file_num:%d, name:%s):%d,%d %s/%s/%s_%d.jsonadd device(file_num:%d, name:%s):%d,%d%s-%s-%dtag:%s, val:%s%d,%ssend error-1(%d)*** send error-1 ***send error-2(%d)*** send error-2 ****** socket error ****** bind error ***waiting...execbuf_out file_num:%d,model_id:%d,cmd:%d data:%s*** TcpDriverWriteEventTask error ***buffile_num:%d,model_id:%d,model_subid:%d,cmd:%d data:%sime{"cmd":"ignore"}socket failed(%04X) bind failed(%04X) socket send failed(%04X) *** socket send error ***socket connect failed(%04X) *** socket connect error ****** socket open error ***send file_num:%d,model_id:%d,cmd:%d data:%svendor:%d file_num:%dsend(name:%s), json: %sIPTABLE ID(%s) not found dbgAct model:[%d], subid:[%d], name:[%s], vendor:[%s], sys_tag:[%s] types:[%s], basic_types[%s], cms_act[%s] attr[], size:[%d] dev_tag[], size:[%d] i:%d attr:[%s] attr_def:[%s] attr_verbose: %s ----------------------------- i:%d dev_tag:[%s] dev_def:[%s] Model is not foundunknownFeibitGatewayundef%s/%s/proft_0.json%s/%s/scene_%d.jsonCan't get model name(model:%d, subid:%d)%s%dscENeZc8h_create[file:%s,func:%s,line:%d], [model_id]:%d, [model_subid]:%d, [name]:%screate error [name]:%s, [model_id]:%d, [model_subid]:%dunknown din subid:%dmodel_subid:%dupd can(file:%d, m:%s, dip:%02X ct:%d)pwronupd can(file:%d, m:%s, dip:%02X, ct:%d)ARM_LED should be hide.%s_%d_%s_%dnewnew can(file:%d, m:%s, dip:%02X, ct:%d)ip:%s snid:%s mac:%s_devMacctrlb exist(file_num:%d, name:%s) CtrlB-%s-%dCtrlBadd ctrlb device(file_num:%d, name:%s)[model_id]:%d, [model_subid]:%d, [name]:%smodeliddevidOldAirCond(%s,%s)%s_devid(%s)_%s%s_devid(%s)NewAirCond:%s%s-%dmodelnameadd air cond(file_num:%d, name:%s)OldCustomDev(%s,%s)NewCustom:%sadd custom device(file_num:%d, name:%s)fancoilbasiccreatorattrattr_verbosespace_name%s,%sscene_groupscene_userinp_timerweekinp_filelogicfile_groupconditioncmt{"file":"%d","file_serial":"%d"}securityfull_listpack full list errorpack select error%s(model_id:%d, model_subid:%d), %sReega_RO_0410volksenReegaContactsunit_addrgw_ippt192.168.0.1sw00000Reega_RO_0416Reega_CC_0410ReegaCurtainoopcc_addrcrtn3crtnReega_DM_0410ReegaDimmerbridm_off4.2dlt"bri":{"title":"亮度","mode":"rw","range":{"lb":"0","ub":"255","step":"1"}}Reega_CXX_0410ReegaMacro#trigmacroSasWell_SS810saswellSaswelltemp_settemp_nowfan_a25coolSAS810322_110382435CC00D04610110"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]},"temp_set":{"title":"温度设定","mode":"rw","unit":"摄氏","range":{"lb":"16","ub":"30","step":"1"}},"temp_now":{"title":"现在温度","mode":"ro","unit":"摄氏"},"cond_opa":{"title":"模式","mode":"rw","combo":[{"v":"heat","n":"风机制热"},{"v":"cool","n":"风机制冷"},{"v":"floorheat","n":"地暖"},{"v":"mixheat","n":"风机地暖"}]},"fan_a":{"title":"风速","mode":"rw","combo":[{"v":"low","n":"低速"},{"v":"mid","n":"中速"},{"v":"high","n":"高速"},{"v":"auto","n":"自动"}]}SasWell_T13322_210382435CC0023ED"temp_set":{"title":"温度设定","mode":"rw","unit":"摄氏","range":{"lb":"16","ub":"30","step":"1"}},"temp_now":{"title":"现在温度","mode":"ro","unit":"摄氏"},"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]}PML1000_ContactPML1100PML1100ContactFFFFFFFFFeibit_Gatewaysngw_type10000Feibit_CommonFeibitDevice_profile_id_device_id_zone_type_ieee000000000000000011110Feibit_RelayFeibit_CurtainFeibit_ColorDMhuesatlig"hue":{"title":"色调","mode":"rw","range":{"lb":"0","ub":"255","step":"1"}},"sat":{"title":"饱和度","mode":"rw","range":{"lb":"0","ub":"255","step":"1"}},"lig":{"title":"亮度","mode":"rw","range":{"lb":"0","ub":"255","step":"1"}}Feibit_Doorlockunlock888888normaldlock11000Feibit_PlugFeibit_TempHum$temp_now$hum_nowsnsrFeibit_Smoke$alarmbattnormFeibit_FloodFeibit_GasFeibit_PIR01000Feibit_EmergencyFeibit_MRSWFeibitSceneLumex_GatewayLumexGatewaytoken_key21232f297a57a5a743894a0e4a801fc3Lumex_SwLumexDevice_appLumex_DMLumex_Curtainlevel"level":{"title":"位置","mode":"rw","range":{"lb":"0","ub":"100","step":"1"}}Lumex_AirCondmodemid"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]},"temp_now":{"title":"现在温度","mode":"ro","unit":"摄氏"},"temp_set":{"title":"温度设定","mode":"rw","unit":"摄氏","range":{"lb":"19","ub":"30","step":"1"}},"mode":{"title":"模式","mode":"rw","combo":[{"v":"cool","n":"冷气"},{"v":"heat","n":"暖气"},{"v":"dry","n":"除湿"},{"v":"fan","n":"风扇"}]},"fan_a":{"title":"风速","mode":"rw","combo":[{"v":"low","n":"低速"},{"v":"mid","n":"中速"},{"v":"high","n":"高速"}]}Lumex_FancoilENGRECOVERYLOW"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]},"mode":{"title":"模式","mode":"rw","combo":[{"v":"ENGRECOVERY","n":"能量回收"},{"v":"AERATION","n":"自然换气"}]},"fan_a":{"title":"风速","mode":"rw","combo":[{"v":"LOW","n":"低速"},{"v":"MIDIUM","n":"中速"},{"v":"HIGHT","n":"高速"}]}Lumex_UFHeat"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]},"temp_set":{"title":"温度设定","mode":"rw","unit":"摄氏","range":{"lb":"19","ub":"30","step":"1"}},"temp_now":{"title":"现在温度","mode":"ro","unit":"摄氏"}Giga_CameragigatechGigaCamerapicrecnoneurlrtsp://192.168.0.1:554/av0/cameraGiga_IndoorGigatechIndoorZ9999999nowDooyaCurtainDooyaRs485Curtainuartportbaudrate/dev/ttyS19600,n,8,105fe00111A_OkCurtainA_Ok2400,n,8,10401ElectricScreen01WintomCurtainHuaYueSwHuaYue328/dev/ttyS2010100110PPL1000GigaIotDeviceabctype_scenetype_swtype_dlttype_crtntype_condIR_EM2110_GATEWAY_snidgiga_irIR_REMOTEauto_windwind_dirlow_indexir_noneIR_ALARM15ir_alarmGiga_DICanDevicedi_nonc"oo":{"title":"开关","mode":"ro","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]}Giga_DOdo_buzr"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]}Giga_GASgas00010"oo":{"title":"开关","mode":"wo","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]},"gas":{"title":"瓦斯开关状态","mode":"ro","combo":[{"v":"on","n":"瓦斯开启"},{"v":"off","n":"瓦斯关闭"}]}Giga_SWoo_srcint"oo":{"title":"开关","mode":"rw","combo":[{"v":"on","n":"开"},{"v":"off","n":"关"}]},"oo_src":{"title":"命令来源","mode":"ro","combo":[{"v":"int","n":"内部"},{"v":"ext","n":"外部"}]}Giga_DLvolt_lbvolt_ubvolt_pwrdlt_ooGiga_RGBWc_modec_levelw_levelh_vrgbwGiga_Curtain10111CustomizeUartUartParaport_rs485databitstopbitdata_typedata_snull-datapushport_rs232Giga_AirMentorCustomDevco2pm2.5pm10tvocsrhbatteryairmentorGiga_Yaleyalelockstatusdoorstatus400600PDN1000PDN1000(主机)-瓦斯安全开关PDN1000(主机)-DO接点(1)PDN1000(主机)-DO接点(2)PDN1000(主机)-DI接点(1)PDN1000(主机)-DI接点(2)PDN1000(主机)-DI接点(3)PDN1100%s(V%d)_%s_接点(1)%s(V%d)_%s_接点(2)PDN1120%s(V%d)_%s_DI接点(1)%s(V%d)_%s_DI接点(2)%s(V%d)_%s_DI接点(3)%s(V%d)_%s_DI接点(4)%s(V%d)_%s_DI接点(5)%s(V%d)_%s_DI接点(6)%s(V%d)_%s_DO接点(1)%s(V%d)_%s_DO接点(2)%s(V%d)_%s_DO接点(3)%s(V%d)_%s_DO接点(4)%s(V%d)_%s_DO接点(5)%s(V%d)_%s_DO接点(6)PDN1140%s(V%d)_%s_接点(3)%s(V%d)_%s_接点(4)PDN1140DPDN1150PDN1160PDN1170PSW1000PSW1010PSW1020PSW1030PSW1040PSW1070PSW1080PDN1000(主机)-DI接点(4)PDN1000(主机)-DO接点(3)PDN1000(主机)-DO接点(4)PDN1000(主机)-ARM_LEDDRIVER_CMD_STARTDRIVER_CMD_WRITEDRIVER_CMD_RENAMEDRIVER_CMD_REMOVEDRIVER_CMD_GATEWAY_RESTARTDRIVER_CMD_GATEWAY_PARADRIVER_CMD_POWER_ONDRIVER_CMD_SCAN_NEWDRIVER_CMD_CLEARDRIVER_CMD_LOAD_SECUDRIVER_CMD_IO_EVTDRIVER_CMD_HELLOCreateDev_sCreateFeibitDeviceGetFeibitDevInfoAddFeibitDeviceTestCloseSocket".(WrFeibit_IRFEIBIGFEIBIGWrFeibit_Lock". ". z". WrFeibit_ColorDmUX. ' RdFeibit_ColorDmWrFeibit_Oop  \RdFeibit_Oop WrFeibit_RemoveWrFeibit_LearnFindGatewayKillZllGatewayExecZllGatewayZllTaskCloseFeibitSocketFeibitStartRecvFeibitDrvTaskarg nulladdr:%04X, ep:%X, Lock, open_lock:%daddr:%04X, ep:%X, Lock, method:%d, report:%daddr:%04X, ep:%X, temp:%f(%04X), wet:%daddr:%04X, ep:%X, temp:%f(%04X)addr:%04X, ep:%X, humidity:%f(%04X)addr:%04X, ep:%X, alarm:%04Xaddr:%04X, ep:%X, , cluster_id:%04X, attr_id:%04X, data_type:%02X, unknowngateway responseinfo->zone_type:%04X, zone_type:%04Xshort_addr:%04X,end_point:%X,profile_id:%04X,device_id:%04X,on_line:%d (Unknown) short_addr:%04X,end_point:%X,profile_id:%04X,device_id:%04X,on_line:%d force close feibitir key:SendErr3 cmd_wroop:SendErr dm ooSendErr oo dm ligSendErr lig dm hue/satSendErr hue/sat SendLightErr SendHueErr SendSatErr cmd_rdremove:learn:------------------------------------------ sn:%s ip:%s connected:%d internal gateway.Search External Gateway(sn:%s)Err(%s,open) setsockopt (SO_BROADCAST)SendErr(%d,%s) BroadcastSuccess(%d)RecvErr(%d) SN:SnMatch(%s,%s), ip:%s SnNotMatch(%s,%s), ip:%s Stop search gateway***** exec [killall zllGateway.bin] *****killall zllGateway.bin***** exec [zllGateway.bin] *****zll task start!Stage 1Stage 2zllGateway.bin ready!close sockettrigrecv bin:found nothing:%04X %04XOPENLOCK_RESULT:%d LOCK_REPORT:%d, report:%d CreateFeibitDevice Finishinit sn:[%s],[%d]; gw_type:[%d][%d]new gateway_sn:%snew gw_type:%dclear gatewayRemove Feibit(short:%s, end:%s)_dev.dev_para.cnt:%dupd oo:%supd hue:%dupd sat:%dupd lig:%diot_p.cnt:%dconnect to interval.connect to external(%s).255.255.255.255no data.....Find server resp bin:STATE_DEV_INITSTATE_DEV_FOUNDSTATE_GATEWAY_SEARCH(RESTART-1)LEARN FEIBIT DEVSendErr gateway infosend alive gateway is dead. reconnect.... reconnect gateway.NULLfeibit_gw_typeFeibitDrvTaskZigbeePlugZigbee插座ZigbeeRelayZigbee开关ZigbeeCurtainZigbee窗帘ZigbeeColorDMZigbeeZigbeeColorDMZllZigbee彩灯ZigbeeDoorLockZigbee彩灯(1)ZigbeeLittlePlugZigbeeTempHumZigbee温湿度传感器ZigbeeSmokeZigbee烟雾侦测器ZigbeeFloodZigbee水淹侦测器ZigbeeGasZigbee瓦斯侦测器ZigbeePIRZigbee人体红外侦测器ZigbeeEmergencyZigbee紧急按钮ZigbeeMRSWZigbee磁簧开关ZigbeeSceneZigbee情境按钮无内置外部iotIR_AlarmiotIR_sendPropertyEM2110iotDevJoiniotRegToIotmiotDevRemoveiotDevDisplayControlBoardBroadcastControlBoardUnicastiotDevCoupleStartiotDevPrsSendRemoteUartnxSendLocalUartGigaDrvTaskReqDinSet_DOReqDinSet_DLReqDinSet_OO_DLReqDinSet_DLLUSearchCanDevPrsStartScanCanDeviceIotCanRecvStartGigaIotTaskinvalid formatirIndexir*** Unknown Iot Device(ip:%s, subid:%d, snid:%s)*** IR Gateway profile error(1)add(%d, %s, %s)joininvalid ipdevVerCompare ID(GroupId:%s, iotm_id:%s, iotm_subid:%d)Invalid Iotm(iotm_id:%s, iotm_subid:%d){"success":"true","dev_list":"false","now":{"yy":"%d","mm":"%d","dd":"%d","hour":"%d","min":"%d","sec":"%d"}}JoinR(model_id:%d, model_subid:%d, dev_ip:%s){"success":"true","dev_list":"true","now":{"yy":"%d","mm":"%d","dd":"%d","hour":"%d","min":"%d","sec":"%d"}}Join1st(model_id:%d, model_subid:%d, dev_ip:%s)removeremove control board[model id:%d, model subid:%d snid:%s]******************model_id:%d, model_subid:%d, snid:%s, ip:%s, ver:%s, alive(%d) Total:%d ******************model_id:%d, model_subid:%d, ip:%s stop pairmodel_id:%d, model_subid:%d, snid:%s, ip:%s {"action":"uartopen","data":{"com":"1","baudrate":"%d,%c,%d,%d","mode":0,"dstport":54554}}org data:[%d], [%s], us_delay:%duart bin{"action":"uartclose"}connect fail[ip:%s]/dev/ttyS%dorg data:[%d], [%s], dev[%s], br[%d], bits[%d], parity[%c], stop[%d];local uartget ip error.{"action":"iotmUnlink","data":{"iotmId":"%s","iotmSubId":"%d","devSn":"%s"}}unlink connect fail(ip:%s)unlink ok(ip:%s){"action":"irRename","data":{"subid":"%s","irIndex":"%d","irName":"%s"}}Ignore(offline).dipid:%02X, subid:%dinvalid contact_g.oo.val:%s len:%dcan't find ir gateway. check command:[ctrlb]ir index is missing.irActionirCmd***** CanR1 is not exist ********** SEARCH CAN NEW DEV ********** Search Can device ********** Scan New Can device(Finish). *****{"action":"iotDinSet","_id":"%d","_subid":"%d","dev_sets":[{"ct":"%d","%s":"%s"}]}to din: %s,"oo":"%s","bri":"%d"{"action":"iotDinSet","_id":"%d","_subid":"%d","dev_sets":[{"ct":"%d"%s,"volt_lb":"%d","volt_ub":"%d","volt_pwr":"%d"}]}{"action":"iotDinSet","_id":"%d","_subid":"%d","dev_sets":[{"ct":"%d","oo":"%s","volt_lb":"%d","volt_ub":"%d","volt_pwr":"%d"}]}{"action":"iotDinSet","_id":"%d","_subid":"%d","dev_sets":[{"ct":"%d","volt_lb":"%d","volt_ub":"%d","volt_pwr":"%d"}]}{"action":"iotSearch"}***** EXEC *****PREPARE....STARTdev_setscmd:%d, id:%d, subid:%d, contact:%d, ver:%dvolt_lb_pdn1160volt_ub_pdn1160volt_pwr_pdn1160/giga_iot_queuecreate can queue/can_iot_r1/can_iot_iotmcreate can queue finishGigaDrvTaskdevRegIotmsendPropertyEM2110irAlarm字符串(String)10进位(DEC)16进位(HEX)无(None)奇(Odd)偶(Even)1bit2bit7bits8bits3001200240048009600192003840057600748801152002304004608009216005.0V5.5V6.0V6.5V7.0V7.5V8.0V8.5V9.0V9.5V10V1.5V2.0V2.5V3.0V3.5V4.0V1次方2次方3次方GigatechTaskSendtestWrLogpictureCellPhoneID230_1_B1001001_3TypeAttrAction/giga_queueParseHuaYueTcpCmdHuayueTaskSendSendHuayueCommandmodeidmodesubidbauddeviceidrespoo_buf:%s{"action":"SetDBusOutput","data":{"oo":"%s","modeid":"%d","modesubid":"%d","port":"%s","baud":"%s","deviceid":"%s"}}Huayue: %s resp_patch/huayue_queueGetDBusStatusRespDBusStatusIotAliveTaskcbBrowseIotFile_SearchFeibitGw_xIOT_DIRTYiotQBusydispIotmSceneFilesdispIotmFilesAlliotLogEventCreateSpecialSceneFileiotmUpdParaByDrv_iotAttachScene_iotRemoveAttachScene_ModifySceneEventiotRemoveLog_iotAddLogProcessSceneGroup_iotmUpdateFile_iotExecSceneFileProcessScene_iotmInitFilecbBrowseIotFile_ScenecbBrowseIotFile_Norm_iotmNewFile_IsSceneEventPass_iotUpdAttrItem_drvUpdIotParaSchdCbSceneiotLoadProfileiotDelProfilePath_iotRemoveFileiotRemoveZombieFileiotRemoveLogicalFileiotRegProfilePath_iotWrToDiskUpdCtrlBDataIotCoreTaskIotFileFlushPrs**** EXIT PROGRAM(alive fail-1) ******** EXIT PROGRAM(alive fail-2) ****ClrAliveTaskWdtCnt_1:%d, ClrAliveTaskWdtCnt_2:%dfile dirty(num:%d, file:%s, func:%s, line:%d)q cur size:%d/iot_queue**** file_num:%d, file_serial:%d, model_id:%d, model_subid:%d, dev_ver:%d, new_din:%d active:%d, enable:%d, type:%s, name:%s, creator:%s, gw_found:%d, ipt_id:%s dev_para_cnt:%d attr_cnt:%d index[%d]-> tag:%s, val:%s alt_tag_cnt:%d fd_space_name:%s cmt:%s scene_user_num:%d scene_group_num:%d index[%d]-> scene_user:%s index[%d]-> scene_group:NULL index[%d]-> scene_group:%s *attach_scene:%d *inp_timer exist, inp_timer_num:%d index[%d]-> inp_timer.time:%s, week:%s log_cnt:%d *inp_file exist, group_num:%d, logic:%s, trig:%d --file_num:%d, attr_num:%d, logic:%s tag:%s, val:%s, logic:%s, result:%s tag:%s, val:%s, logic:%s tag:%s, max:%d [%02d] NULL [%02d] file_num:%d, serial:%d, name:%s total files:%d SysProft:%d, LastUpdateDate:%s wb*********** tag:%s, input:%s, logic:%s, val:%s result:%s %uCreate Nowscene_special_%d.json{"cnfg":{"file":"%d","file_serial":"%d","type":"scene","basic":"scene","name":"button_%d","enable":"1","active":"1","creator":"300_1_B1001003_1","attr":["exec"],"fd":{"space_name":"not define","para":{"exec":"now"},"log":{"exec":"upd,ignore"},"scene_group":[],"scene_user":[],"inp_timer":[],"inp_file":[],"cmt":""}},"dev_cnfg":{"model_id":"320","model_subid":"1","ipt_id":"scENeZc8h_%d","para":[]}}src/iotm_f.ctarget:%d, scene:%dinvalid file num:%dmodifyallocate filenum errormissing filenumScene Control File Is Null(file_num:%d).Scene Control File Is Invalid(file_num:%d).scene file(%d) errorinhibitfilenum(%d) is not active[attr=data]:%s=%sfile_num(%d) is not foundexec scene, filenum:%dinp_file(file_num:%d, name:%s)now(file_num:%d, name:%s)inp_timer(file_num:%d, time:%s, week:%s)deployzone*** file_serial error ***dev_cnfgPatch(UpdateIptId)(%s, %s):reset scene model id(fnum:%d)Kill Dup-File(%s, %s):old scene file patch:dev_cnfg(fnum:%d)old scene file patch:creator(num:%d)ErrorModel(filenum:%d, model_id:%d, model_subid:%d)ErrorFeibitModel(filenum:%d, model_id:%d, model_subid:%d)FeibitPatchSaving(%02X)(fnum:%d)scene_file:%sKeep previound file(%s) serial(%d) for sceneSpecial scene is not exist: %s Edit special scene:%dscene:%dcheckidx:%d, group_trig[group_idx]:%dfilenum:%d, tag:[%s], val:[%s]user_id{"file":"%d","file_serial":"%d","para":{"%s":"%s"}}cnt:%d, dev_p->cnt:%dkill: file_num(%d),user(%s) Date:%s, ExecScene file_num(%d),user(%s) Start Remove SQL IOT FILEComplete.../Apps/IOTDeviceSystem/DeviceFiles.ashx?ACTION=delete&FILENAME=%sreg profile%sresponse from cms: %sremove iot file(file_num:%d)kill missing file:%d, name:%snumber of removed files:%d Delete special scene is not permitted/Apps/IOTDeviceSystem/DeviceFiles.ashx?ACTION=modify&FILENAME=%swrite iot file(file_num:%d): %sadd scene{"action":"IotReloadItems","sys_proft":"%d"}ctrlb adj:%dmodified json: %s counterIotModifyCounter:%dFileNewDelFlushCount:%dSysProftnew proft:%d%d.%02d.%02d %02d:%02d:%02dIotNotifyCounter:%dIOT_CMD_TICKIOT_CMD_EXECWriteMemoryCallbackCbBusyLumexTaskTickSecCreateDevUpdLumexDevCreateLumexDeviceParseLumexTcpCmdParseWrCmdResplumex_messageLumexTaskSendCreateDev_sGetLumexApps**** OVERFLOW(max:%d, now:%d)statget_profile_cnt:%dprepare get all profileaddapp[%d], group[%d], type[%s]groupstatePOWERINDICATORTEMPSETFANSPEEDTIMMERTEMPSENSORMapStringR2L(err)fanspeed with error parameter:%s %s(%s)tokenGet Lumex token:%sLUMAXipGet Lumex ip:%sGet Lumex port:%dGet Lumex Parameter.learnirresult is [%s], cmd is [%s]applearn ir json error:%streeappsgroupsunknown device type!add_devapp[%d], group[%d], type[%s], level[%d], state[%s] http://%s:%d%surl:[%s] cmd:[%s]PUTerror code(%d), [%s]resp data: %s 192.168.0.98EGaOmC3D9pzmAOBh3bnn943yc50i1VMd{"action":"findlumax"}cmd:%s, data:[%s] Start Search Lumex Gatewayrestart lumex:%s %s{"token":"%s","cmd":"tree","param":"states"}get device list error:%sGATEWAY_PARA:%s %s %dzero argmodel_subid:%d, gw_found = 0GateWay is not ready.{"token":"%s","cmd":"on","app":"%d","group":"%d"}{"token":"%s","cmd":"off","app":"%d","group":"%d"}error??Jd.oo_data:%s, Jd.oo_valid:%dJd.bri:%d, Jd.bri_valid:%dlevel:%d{"token":"%s","cmd":"ramp","app":"%d","group":"%d","level":"%d%%"}{"token":"%s","cmd":"stop","app":"%d","group":"%d"}{"token":"%s","cmd":"ACControl","app":"%d","group":"%d","power":"%s","indicator":"%d","tempset":"%d","mode":"%s","fanspeed":"%s","timmer":"%s"{"token":"%s","cmd":"FCControl","app":"%d","group":"%d"{"token":"%s","cmd":"UFHControl","app":"%d","group":"%d"{"token":"%s","cmd":"tree","param":"apps","param":"states"}gateway ip:%s/lumex_queueMIDIUMhighHIGHTAUTOSwitchDimDimmerAirconAirCondFancoilFANCOILUFHeatUFHEATcbBrowseIotFilecbBrowseDeviceFileinit error json: %s dev_fileiotm_devvalid:%d "enable":"2""enable":"1"regenerate: %s ** merge dev:%d **dev_tagdev dir is not exist. keep continuedev dir existmv %s/%s %s/iotm_dev_oldwtfailed to open pid file:%s:%s Pml1000TaskSendSendPml1000CommandPml1000UpdIocmdPML1100pml_1000: %s refresh counter(%s)new counter(%s)ipt not exist(model_id:%d, model_subid:%d, id:%s, subid:%d)data buf:[%s]data token error/pml1000_queueI2cWriteI2cReadSendToIotm_ConvPwmStepToBriUpdDevDI_zRespDataToIotR1_ReadBuffR1_WriteBuff_AR1_ResetCanBusyR1_InhibitRegR1_ScanAllDeviceR1_ScanAllNewDeviceStartCanErrRecdCanWrite_SayHiR1_WriteByteR1_ReadThenWriteByteR1_ReadByte_WrCanBufCanWrite_DOCanWrite_DO_BufUpdDevDI_R1_zAddNewDevMacdbgRdDevPooldbgWrDinCmddbgRdGpiodbgWrI2cCandbgRdI2cCandbgWrWdtOffR1TickTaskCheckR1ModeCheckCanStatusr1_init**SYSEXIT(%s,%s,addr:%02X). exit now.i2c failto iotm: %s{"action":"iotDinAct","_id":"%d","_subid":"%d","_local_sn":"%08X","_ver":"%d","dev_sets":[{"action":"iotDinAct","_id":"%d","_subid":"%d","_local_sn":"%08X","dev_sets":[ext{"cmd":"%d","_id":"%d","_subid":"%d","_ver":"%d","dev_sets":[{"ct":"%d","oo":"%s","oo_src":"%s"},{"ct":"%d","oo":"%s"}{"ct":"%d","oop":"off"}pwm:%d, %d %d{"ct":"%d","bri":"%d"}{"ct":"%d","oo":"%s","bri":"%d"}inc{"ct":"%d","hue":"%d","sat":"%d","lig":"%d","c_level":"%d","w_level":"%d","h_v":"%d","oo":"%s","c_mode":"%s"}{"ct":"%d","hue":"%d","sat":"%d","lig":"%d","w":"%d"}{"ct":"%d","hue":"%d","sat":"%d","lig":"%d","w":"%d","oo":"%s"}{"ct":"%d","oo":"on"}{"ct":"%d","oo":"off"}iotm is not ready{"cmd":"%d","_id":"%d","_subid":"%d","dev_sets":[{"ct":"%d","%s":"%s"}]}{"cmd":"%d","_id":"%d","_subid":"%d","dev_sets":[%s]}resp: %sread error(retry:%d, %02X)**SYSEXIT(%s,%s). exit now.pkt:write error(%02X)Cannot read R1 CPU!FailOk CanAccessNum(%d) CanErrRecdNum(%d) Record Start:%s %s(dipid:%02X subid:%02X) retry(%d) timeout(%d ms) diff(%d sec) t(%s) dipid:%02X subid:%02X**** Cannot Access R1 ****success(%02X = %d)***CanWrError(dipid:%02X subid:%02X, st(%02X):%02X)***CanError(dipid:%02X subid:%02X)(retry_times:%d, resp:%d, step:%d)***CanBusy (dipid:%02X subid:%02X)(retry_times:%d, resp:%d, step:%d)***CanReset(dipid:%02X subid:%02X)(retry_times:%d, resp:%d, step:%d)WrCanSuccessTO(dipid:%02X subid:%02X, retry:%d, timeout:%dWrCanSuccess(dipid:%02X subid:%02X, timeout:%d)WriteCanError(dipid:%02X subid:%02X)Rd I2c(R1DI):CT_R1_MAX:%dnew can. subid:%02X dipid:%02Xsame can. subid:%02X dipid:%02Xdev_id page:%d, len:%dRd I2c(DEV_ID):mac:%02X %02X %02X %02X %02X %02X intr:%d, busy:%d%02X(%d) = %dR1VerMajor:%d, R1VerMinor:%d, R1CanDevNum:%d [%02d] subid:%02X(%d) dipid:%02X ver:%d, %s, online:%d **** WDT(%d, %s) ******StartScanNewDev StartScanDev **** MACHINE(%02X) ********** R1 ERROR(0) ******R1VerMajor:%d, R1VerMinor:%d **** R1 ERROR(1) ********** WRITE DEV BANK ERROR ********** R1CanDevNum:%d ********** R1CanDevNum:%d(PDN1180, NO CANBUS) ********** R1 ERROR(2,%d) ******gpio_input:%d Rd I2c(I2C_INTR):devid: %02dRd I2c(DEVDI):/var/run/r1.pid********main start /dev/i2c-0HW info i2c device cannot open!********** INIT MODEL TO PDN1180 *********************** INIT MODEL TO STD *************"c_mode":{"title":"模式","mode":"rw","combo":[{"v":"w","n":"白"},{"v":"custom","n":"自定义"},{"v":"r","n":"红"},{"v":"g","n":"绿"},{"v":"b","n":"蓝"}]}customParseSaswellTcpCmd5 5 5 CustomTaskSaswellTaskGetEmptyAirCondParaDispModelDefaultByDevidCbDef_DaikinLoadAirConditionProfileLoadAirCondPerformanceSaswellTaskLoopLoadAirCondTxtGetCustomDeviceListperfomancejs(%s): %s--- Get Performance(%s) ---322_4330_101330_1YALE: %syale update tag:%s val:%spincodeunlockpara idx(%d), tag:%s, val:%spara_num:%doutputstart cmd: %s{"elock":"unlock"}yale: %s{"elock":"lock"}addonetimepincodesetconfig{"method":"addonetimepincode","data":["%s"]}configlockstatuschecknormal cmd: %s,"%s":%svendor[%s], devid[%s] is existvendor[%s], devid[%s], exist(%d) is not exist(%d) *** devid(%s) Total:%dundef_aircond"%s":%stitlerwcombo{"v":"%s","n":"%s"}lbubstepunitrangefile(%d):%sDEF is exist.offerheatDehumwinddirectionwinddirectautowindspeedwinspeedautocoolmaxcoolminiheatmaxheatminioffer:[%s]heat:[%s]cool:[%s]dehumidify:[%s]winddirection:[%s]winddirectauto:[%s]windspeed:[%s]winspeedauto:[%s]coolmax:[%s]coolmini:[%s]heatmax:[%s]heatmini:[%s]Daikintemp setunit temp nowmode sw onmode sw offmode swSwingwind dir swingStopwind dir pauseP1wind dir 1P2wind dir 2P3wind dir 3P4wind dir 4P5wind dir 5windDirectionwind dir setAutowind speed autowind speed 2wind speed 4wind speed 3LLwind speed 1HHwind speed 5wind speed setOffermode offermode heatCoolmode coolmode dehumidifymode automode setadd cond_opa20mode temp nowverbose:%svendor:%sorg[%s] -> data[%s]a-exist(%d):%dExtract Filefilename:%s%s: %s AirCondProfile[] is ready.performance cmd: %sthe same profile: %sdiff profile: %sair_cond.jsonair_cond.json: %s response list: %s file_buf: %sno response/saswell_queue/custom_queueDaikinAirConddaikindaikin_aircond.json{"action":"getPerformance","dev":{"vendor":"daikin","para":{"modelid":"322_4"}}}wind dir auto   ( _xPostSchedDelay_RemoveSched_xPostSchedTimeSchedualTaskSchedualTaskTick*name:%s(%d,%u), type:SCHED_TYPE_DELAY, delay_ms:%d, counter:%d, arg(%s), scene(%s) *name:%s(%d,%u), type:SCHED_TYPE_HMS_WEEK, hms:%02d:%02d:%02d, week(%02X):%s, arg(%s), scene(%s) *name:%s(%d,%u), type:SCHED_TYPE_YMDHMS, ymdhms:%d-%d-%d %d:%d:%d , arg(%s), scene(%s) Schedual task total:%d Error(event overflow)idx=%d, id->serial:%d time:%s, week:%sformat error:y:%d, m:%d, d:%d, h:%d, m:%d, s:%d,h:%d, m:%d, s:%d, ww:%02X/schedual_task_queueSchedualTask errorexec schd(%d) -- SCHED_TYPE_DELAYremove schd(%d) -- SCHED_TYPE_DELAYreload schd(%d) -- SCHED_TYPE_DELAYexec schd(%d) -- SCHED_TYPE_HMS_WEEKremove schd(%d) -- SCHED_TYPE_HMS_WEEKreload schd(%d) -- SCHED_TYPE_HMS_WEEKexec schd(%d) -- SCHED_TYPE_YMDHMSadjust time. cur_sec(%u), prev_sec(%u), diff(%d)sunmontuewedthufriExecBuzzerBuzzerAutoOffPrsExecActionAlarmLoadSecurityFileMsgLoadNewSecurityFilePostEventToSecurityPostDeployIndoorPostDeployOutdoorPostDeploySleepInitZoneStatusSecurityDrvTask{"oo":"off"}{"oo":"on"}exec:%derror file:%d %dexec off %d. buzzer off %d. buzzer on %d. photo:%s %d. file_num:%d, file_serial:%d, para:%s Security is not configure yet! deploy:%s pwron_delay:%dsecs buzr_off:%dsecs **Buzzer file is empty. **Buzzer number:%d file_num:%d, file_serial:%d ------------- **zone_indoor :[%d, %d, %d, %d, %d, %d, %d, %d] **zone_outdoor:[%d, %d, %d, %d, %d, %d, %d, %d] **zone_sleep :[%d, %d, %d, %d, %d, %d, %d, %d] **zone definition: **act_alarm: zone index:%d file_num:%d, file_serial:%d, cond_max:%d, zone_type:%s, zone_act:%s %d. tag:%s, val:%s, prev_val:%s **act_panic: **act_mute: **act_disarm: buzrphotobuzr_offindexzone_typezone_actcond[]zone_indoorzone_outdoorzone_sleepact_panicact_alarmact_muteact_disarm{"deploy":"%s","buzr_off":"%d","zone":%s,"buzr":%s,"zone_indoor":%s,"zone_outdoor":%s,"zone_sleep":%s,"act_panic":%s,"act_alarm":%s,"act_mute":%s,"act_disarm":%s}Access Denied(deploy now).{"deploy":"arm_indoor"}{"deploy":"arm_outdoor"}{"deploy":"arm_sleep"}{"deploy":"disarm"}cur value(tag:%s, cond_val:%s, cur_val:%s)exec:DEPLOY_DISARMexec:DEPLOY_OUTDOORexec:DEPLOY_INDOORexec:DEPLOY_SLEEPsecurity.jsonnew:%sthe same value(tag:%s, val:%s)zone match(file_num:%d, tag:%s, val:%s)ZONE_TYPE_PANICZONE_TYPE_24HRZONE_ACT_NORMALZONE_ACT_MUTEZONE_TYPE_DEPLOYsecurity.json: %s SecurityDrvTask24hrtype_erract_errarm_outdoorarm_indoorarm_sleep0123456789ABCDEFsysLogPrintfzalloc_set_tcp_nodelayGetLocalIpSendUdpDataBinSendAndRecvUdpWriteMemoryCallbackSendTcpStringSendTcpBinTcpConnectTcpServerTaskConsoleCmdInitJsonObjectCreateQueuePktQSendPktCreateQueue_xMboxSend_xMboxRecvQSize_Send_xQSendiotkActiveiotkQSendWriteBinToFileReadBinFromFileReadBinFromFileMallocRemoveWorkingDirFileMapGetString/  $  ( 4 @ H D P   CurlReadingHSVToRGB_255PingDest- %d.%02d.%02d %02d:%02d%d/%02d/%02d %02d:%02d:%02d%02d%02d-%02d%02d%02d0123456789ABCDEF%.*s �%d.%d.%d.%d%s/%s/%ssys_log.txt[%d.%02d.%02d %02d:%02d:%02d] %s open error.*** malloc error ***norm_log.txtDbgMsgBin[%s,%s]%s DbgMsgBin[%s]%s ADDR 00 01 02 03 04 05 06 07 - 08 09 0A 0B 0C 0D 0E 0F|0123456789ABCDEFG ADDR 00 01 02 03 04 05 06 07 - 08 09 0A 0B 0C 0D 0E 0F|0123456789ABCDEFG --------------------+-------------------------------------------------+----------------- --------------------+-------------------------------------------------+----------------- %08lX(%05d,%04X) DbgSplitString:NullDbgSplitString(LineNum:%d) Line(%d):%s FuncTime[%s,%s]socket create failse...GetLocalIp!/neth0socket create failse...ioctl!/nlocal ip:%s, value:%08X /n0.0.0.0IpErr:%s *** SendUdpDataBin Open Error ****** SendUdpDataBin broadcast Error ****** SendAndRecvUdp Open Error ****** SendAndRecvUdp Broadcast Error ***RecvErr(%d,%s) ReceiveTimeout(%s) DbgMsgF[%s]DbgMsgMs[%s,%d.%d]UDFflag:%s, active:%s, cmt:%s dbgToDisk:%d DbgTag[%s,%s,%d ms]Ln:%d DbgTag%s[%s,%s,%d ms] DbgPt[%s,%s,%d ms]Pt:%s DbgLvl[%s,%s,%s,%d ms]DbgLvl[%s,%s,%d ms]Start(%s,%d) ip null step2 *** SendTcpString Open Error ***step3(socket_desc:%d) step4(socket_desc:%d) step5(socket_desc:%d) step6(socket_desc:%d) SendErr(%s,%s) step7(socket_desc:%d) SendErrX(%s,%d) ConnectTimeout(%s) step8(socket_desc:%d) Stop(%s,%d) *** SendTcpBin Open Error ***RecvErr(%s) ConnectTimeout(%s,%d) *** TcpConnect Open Error ***EndDbgPuts[%s,%s,%s,%d ms]DbgPuts[%s,%s,%d ms]%s,%s,%d msDbgLvlBin(%s,%s,%d ms,%s]%sok dbgToDisk:%d CreateJsonObjByString error[JSMN_ERROR_NOMEM]:%s CreateJsonObjByString error[JSMN_ERROR_INVAL]:%s CreateJsonObjByString error[JSMN_ERROR_PART]:%s CreateJsonObjByString error[%d]:%s {,"%s":"%s""%s":"%s","%s":"%d""%s":"%d","%s":"%04X""%s":"%04X","%s","%d"unlink result:%dqueue error[%s]:%d mq errorqueue full(%s).Errorqueue full(%s, %d).error when create mq(MQ_KEY_IOTM_IOTK)Creat Message Error Mute name:[%s], Hold:%s, Try:[%s], Free:[%s] working:%s Err:"%s, %d", path:%s couldn't write whole bufferrbremove file:%s%s/%d_%d.json%s/%d.json%s/%s.json***dir is not existUnknownValueMapGetString(err,%d)MapStringL2R(err)logic_r_errhttp://%s:80%scurl_easy_init() fail. error code(%d), [%s], error url:[%s] h:%f, s:%f, v:%f/usr/bin/test -e %s && echo "exist" || echo "missing"/bin/ping -c 1 %sread:[%s] errorsresult:%d/bin/ps auxignoreresult_passresult_failnot_equless_equmore_equlessmoreperiodDBG_TAGdbg tag statusDBG_PTdbg pt statusDBG_ERRdbg error statusDBG_WDTdbg wdt statusDBG_TCPdbg tcp statuscmsDBG_CMSminicms tcp commandiotbDBG_IOTBrow data of indoor/tutk portiotcDBG_IOTCstage of iot processDBG_IOTFiot filesdevfDBG_DEVFdevice filesDBG_FILEaccess(write/remove) filedrvDBG_DRVdriver statusschdDBG_SCHDvolkDBG_VOLKdevice volksensasDBG_SASdevice saswellDBG_LUMEXdevice lumexDBG_FEIBITdevice feibitiotDBG_IOTgiga iot devicegigaDBG_GIGAdevice gigaregDBG_REGiotRegToIotmVolksenTaskSend &subid:%d, contact:%d, unit:%d, oo:[%s]reega wr(REEGA_DM_0410/16):SendErr(%s) subid:%d, unit:%d, oop:[%s] reega wr(REEGA_CC_0410):reega wr(REEGA_CCX_0410):off:%s, contact:%d, unit:%d, oo:[%s], bri:[%s]reega wr(REEGA_DM_0410):SendOk(%s) /volksen_queuedefaultFragFinishzlibUncomprzlibComprPostFinalDataUnPackFragmentDataCheckFragmentTTLPackFragmentDataSendCmdToIotkLibFragTaskSendDataToIotkRecv, id:%s, len:%d /root/default.txtdata:ZlibUnc fatal error(%d) ZlibUnc xalloc fail CrcOk(size:%d)ZlibErrCrcErrid:%s, index:%d, total:%d, size:%d, id_invalid:%dbuffer fullTTL zerofragzlib error000_0_00000000_0cmd:%d, size:%drecv bufferSet IotkBlkSize:%d Set IotkBlkSize err iotk block size(%d) qLibFragTask error/libfrag_task_queueip:%s port:%ddbgListList name:%s, length:%dFailed to open the bus.Failed to acquire bus access and/or talk to slave.1.2.8L`PZPZ PZ$d $d$d $d $d $d deflate 1.2.8 Copyright 1995-2013 Jean-loup Gailly and Mark Adler `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid code -- missing end-of-blockinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkHN #+3;CScs@@ !1Aa  0@` inflate 1.2.8 Copyright 1995-2013 Mark Adler    (08@P`p    0@`  0@` L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c          | 5 Զ 5 need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfart]=wt%s[%s] %s=%s1YESONTRUE0NOOFFFALSE CONNECT_ONLY is required!Failed to get recent socketeasy handle already used in multi handlegetpeername() failed with errno %d: %sgetsockname() failed with errno %d: %sssrem inet_ntop() failed with errno %d: %sssloc inet_ntop() failed with errno %d: %sCould not set TCP_NODELAY: %s TCP_NODELAY set sa_addr inet_ntop() failed with errno %d: %s Trying %s... Failed to set SO_KEEPALIVE on fd %d Failed to set TCP_KEEPIDLE on fd %d Failed to set TCP_KEEPINTVL on fd %d if!host!Local Interface %s is ip %s using address family %i SO_BINDTODEVICE %s failed with errno %d: %s; will do regular bind Name '%s' family %i resolved to '%s' family %i Local port: %hu Bind to local port %hu failed, trying next bind failed with errno %d: %sImmediate connect fail for %s: %s Couldn't bind to '%s'Couldn't bind to interface '%s'Connection time-outAfter %ldms connect time, move on! Connection failed connect to %s port %ld failed: %s Failed to connect to %s port %ld: %sInternal error clearing splay node = %d Internal error removing splay node = %d Pipe broke: handle %p, url = %s In state %d with no easy_conn, bail out! Resolving timed out after %ld millisecondsConnection timed out after %ld millisecondsOperation timed out after %ld milliseconds with %lld out of %lld bytes receivedOperation timed out after %ld milliseconds with %lld bytes receivedHostname was found in DNS cache L ` | 8 d |  0  h   @  T p   4 H  \    < h  , L  x  @ T p  , P h 0 H `  D h |  L  ( 8 P ` L X p Unknown errorCURLSHcode unknownUnknown error %dNo errorUnknown share optionShare currently in useInvalid share handleOut of memoryFeature not enabled in this libraryPlease call curl_multi_perform() soonInvalid multi handleInvalid easy handleInternal errorInvalid socket argumentUnknown optionThe easy handle is already added to a multi handleUnsupported protocolFailed initializationURL using bad/illegal format or missing URLA requested feature, protocol or option was not found built-in in this libcurl due to a build-time decision.Couldn't resolve proxy nameCouldn't resolve host nameCouldn't connect to serverFTP: weird server replyAccess denied to remote resourceFTP: The server failed to connect to data portFTP: unknown PASS replyFTP: Accepting server connect has timed outFTP: unknown PASV replyFTP: unknown 227 response formatFTP: can't figure out the host in the PASV responseError in the HTTP2 framing layerFTP: couldn't set file typeTransferred a partial fileFTP: couldn't retrieve (RETR failed) the specified fileQuote command returned errorHTTP response code said errorFailed writing received data to disk/applicationUpload failed (at start/before it took off)Failed to open/read local data from file/applicationTimeout was reachedFTP: command PORT failedFTP: command REST failedRequested range was not delivered by the serverInternal problem setting up the POSTSSL connect errorCouldn't resume downloadCouldn't read a file:// fileLDAP: cannot bindLDAP: search failedA required function in the library was not foundOperation was aborted by an application callbackA libcurl function was given a bad argumentFailed binding local connection endNumber of redirects hit maximum amountAn unknown option was passed in to libcurlMalformed telnet optionSSL peer certificate or SSH remote key was not OKServer returned nothing (no headers, no data)SSL crypto engine not foundCan not set SSL crypto engine as defaultFailed sending data to the peerFailure when receiving data from the peerProblem with the local SSL certificateCouldn't use specified SSL cipherPeer certificate cannot be authenticated with given CA certificatesUnrecognized or bad HTTP Content or Transfer-EncodingInvalid LDAP URLMaximum file size exceededRequested SSL level failedSend failed since rewinding of the data stream failedFailed to initialise SSL crypto engineLogin deniedTFTP: File Not FoundTFTP: Access ViolationDisk full or allocation exceededTFTP: Illegal operationTFTP: Unknown transfer IDRemote file already existsTFTP: No such userConversion failedCaller must register CURLOPT_CONV_ callback optionsProblem with the SSL CA cert (path? access rights?)Remote file not foundError in the SSH layerFailed to shut down the SSL connectionSocket not ready for send/recvFailed to load CRL file (path? access rights?, format?)Issuer check against peer certificate failedFTP: The server did not accept the PRET command.RTSP CSeq mismatch or invalid CSeqRTSP session errorUnable to parse FTP file listChunk callback failedThe max connection limit is reachedSSL public key does not match pinned public keySSL server certificate status verification FAILED%s:%dTRUEFALSEConn: %ld (%p) Receive pipe weight: (%lld/%zu), penalized: %s Site %s:%d is pipeline blacklisted Server %s is blacklisted Hostname in DNS cache was stale, zapped Hostname %s was found in DNS cache name lookup timed outPrevious alarm fired off!%255[^:]:%dCouldn't parse CURLOPT_RESOLVE removal entry '%s'! %255[^:]:%d:%255sCouldn't parse CURLOPT_RESOLVE entry '%s'! Address in '%s' found illegal! Added %s:%d:%s to DNS cache --:--:--%2lld:%02lld:%02lld%3lldd %02lldh%7lldd%5lld%4lldk%2lld.%0lldM%4lldM%2lld.%0lldG%4lldG%4lldT%4lldPCallback aborted** Resuming transfer from byte position %lld %% Total %% Received %% Xferd Average Speed Time Time Time Current Dload Upload Total Spent Left Speed %3lld %s %3lld %s %3lld %s %s %s %s %s %s %s#HttpOnly_%s%s%s %s %s %s %lld %s %s%1023[^; =] =%4999[^; ]securehttponlydomainskipped cookie with bad tailmatch domain: %s max-ageexpirespath%s cookie %s="%s" for domain %s, path %s, expire %lld AddedReplacedSet-Cookie:ignoring failed cookie_init for %s # Netscape HTTP Cookie File # https://curl.haxx.se/docs/http-cookies.html # This file was generated by libcurl! Edit at your own risk. # # Fatal libcurl error WARNING: failed to save cookies in %s tf L L<PProxy-%s:%s%sAuthorization: Basic %s Empty reply from serverHTTP/RTSP/Avoided giant realloc for header (max is %d)!Failed to alloc memory for big header!The requested URL returned error: %dBasicDigestProxy-authorization:%s auth using %s with user '%s' ProxyAuthorization:ServerIgnoring duplicate digest auth header. Authentication problem. Ignoring this. Expect:100-continueExpect: 100-continue Host:Content-Type:Content-LengthConnectionInvalid TIMEVALUE%s, %02d %s %4d %02d:%02d:%02d GMTIf-Modified-Since: %s If-Unmodified-Since: %s Last-Modified: %s HEADGETTransfer-Encoding: chunked Accept: */* 1.11.0; User-Agent:Referer:Referer: %s Accept-Encoding:Accept-Encoding: %s Transfer-Encoding:chunkedChunky upload is not supported by HTTP 1.0Host: %s%s%s Host: %s%s%s:%hu ftp://;type=;type=%cAccept:Could not seek streamCould only read %lld bytes from the inputFile already completely uploadedContent-Range:Range: bytes=%s Content-Range: bytes 0-%lld/%lld Content-Range: bytes %s%lld/%lld Content-Range: bytes %s/%lld %s ftp://%s:%s@%s%s HTTP/%s %s%s%s%s%s%s%s%s%s%sCookie: %s%s=%sContent-Length: 0 Failed sending POST requestInternal HTTP POST error!Content-Length:Content-Length: %lld Could not get Content-Type header line!Failed sending PUT requestContent-Type: application/x-www-form-urlencoded %x Failed sending HTTP POST requestFailed sending HTTP requestupload completely sent off: %lld out of %lld bytes Received 101 no chunk, no close, no size. Assume close to signal end Keep sending data to get tossed away! HTTP error before end of send, stop sending HTTP/%d.%d %dLying server, not serving HTTP/2 HTTP %3d RTSP/%d.%d %3dHTTPThe requested URL returned error: %sHTTP 1.0, assume close after body Negative content-length: %lld, closing after transfer Server:Proxy-Connection:keep-aliveHTTP/1.0 proxy connection set to keep alive! closeHTTP/1.1 proxy connection set close! Connection:HTTP/1.0 connection set to keep alive! identitydeflategzipx-gzipContent-Encoding:Last-Modified:WWW-Authenticate:Proxy-authenticate:Location:* < > { } { } | | [%s %s %s]Send failure: %sRecv failure: %sWrite callback asked for PAUSE when not supported!Failed writing body (%zu != %zu)Failed writing headerHeaderDatafrom X<  x 8 8 $ D) * - l1 h %llu-IDN support not present, can't parse Unicode domains , /etc/ssl/certs/ca-certificates.crtALLSESSFLUSHRELOADCURLOPT_SSL_VERIFYHOST no longer supports 1 as value!Closing connection %ld Connection %ld seems to be dead! Connected to %s (%s) port %ld (#%ld) User-Agent: %s Connection cache is full, closing the oldest one. Connection #%ld to host %s left intact DICTftphttppop3smtpIMAPLDAPcan pipelinecan multiplexseriallyhostIllegal characters found in URL%15[^ :]://%[^ /?]%[^ ]%[^ /?]%[^ ] malformedFTP.DICT.LDAP.IMAP.SMTP.POP3.Rebuilt URL to: %s %25Please URL encode %% as %%25, see RFC 6874. Invalid network interface: %s; %s Protocol "%s" not supported or disabled in libcurl%s://%smemory shortageno_proxyNO_PROXYhttp_proxyall_proxyALL_PROXYsocks5hsocks5socks4asocks4socksInvalid IPv6 address format No valid port number in proxy string (%s) [%*45[0123456789abcdefABCDEF:.]%cIPv6 numerical address used in URL without brackets%s://%s%s%s:%hu%s%s%sPort number out of rangeCouldn't find host %s in the .netrc file; using defaults anonymousftp@example.comFound bundle for host %s: %p [%s] Server doesn't support multi-use yet, wait Server doesn't support multi-use (yet) Could pipeline, but not asked to! Could multiplex, but not asked to! Connection #%ld isn't open enough, can't reuse Pipe is full, skip (%zu) Penalized, skip Multiplexed connection found! Found pending candidate for reuse and CURLOPT_PIPEWAIT is set Found connection %ld, with requests in the pipe (%zu) We can reuse, but we want a new connection anyway Re-using existing connection! (#%ld) with %s %s No more connections allowed to host: %d No connections available in cache No connections available. Unix socket path too long: '%s'Couldn't resolve host '%s'Couldn't resolve proxy '%s'://%15[^:]:%[^ ]4 uD @default/MATCH:/M:/FIND:lookup word is missing CLIENT libcurl 7.48.0 MATCH %s %s %s QUIT Failed sending DICT request/DEFINE:/D:/LOOKUP:CLIENT libcurl 7.48.0 DEFINE %s %s QUIT CLIENT libcurl 7.48.0 %s QUIT %%%uOperation too slow. Less than %ld bytes/sec transferred the last %ld seconds` , < h @ p H x P   libcurl/7.48.0armv7l-unknown-linux-gnueabihfdictgopherimaprtsptelnettftp%%%02X0123456789abcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ(nil)(nil).%ld    ( 0 8 @ H P ` h t    \ $ 0 @ H | @ t ث@@USER,%s%127[^= ]%*[ =]%255sTTYPEXDISPLOCNEW_ENVWS%hu%*[xX]%huSyntax error in telnet option: %sBINARYUnknown telnet option %sRCVDSENT%s IAC SB (terminated by %u , not IAC SE!) (Empty suboption?)%s (unsupported)%d (unknown)Width: %hu ; Height: %hu IS SEND INFO/REPLY NAME "%s" = %.2xSending data failed (%d)EXOPLDONTDOWONTWILL%s IAC %s %s IAC %d %s %s %s %s %s %d %s %d %d %c%c%c%c%s%c%c%c%c%c%c%127[^,],%127s%c%s%c%sIn SUBOPTION processing, RCVDTime-outTELNETEOFSUSPABORTEORSENOPDMARKBRKAOAYTECELGASBIACECHORCPSUPPRESS GO AHEADNAMESTATUSTIMING MARKRCTENAOLNAOPNAOCRDNAOHTSNAOHTDNAOFFDNAOVTSNAOVTDNAOLFDEXTEND ASCIILOGOUTBYTE MACRODE TERMINALSUPDUPSUPDUP OUTPUTSEND LOCATIONTERM TYPEEND OF RECORDTACACS UIDOUTPUT MARKINGTTYLOC3270 REGIMEX3 PADNAWSTERM SPEEDLFLOWLINEMODEOLD-ENVIRONAUTHENTICATIONENCRYPTNEW-ENVIRONHOME machineloginpassword.netrc%%%02xoperation aborted by callbackRead callback asked for PAUSE when not supported!read function returned funny value%x%sseek callback returned error %dthe ioctl callback returned %d ioctl callback returned error %dnecessary data rewind wasn't possibleThe requested document is not new enough The requested document is not old enough select/poll returned errorRewinding stream by : %zd bytes on url %s (zero-length body) Excess found in a non pipelined read: excess = %zd url = %s (zero-length body) Ignoring the response-body The entire document is already downloadedHTTP server doesn't seem to support byte ranges. Cannot resume.Simulate a HTTP 304 response! Failed writing data%s in chunked-encodingLeftovers after chunking: %zu bytes Rewinding %zu bytes Rewinding stream by : %zu bytes on url %s (size = %lld, maxdownload = %lld, bytecount = %lld, nread = %zd) Excess found in a non pipelined read: excess = %zu, size = %lld, maxdownload = %lld, bytecount = %lld we are done reading and this is set to close, stop send Failed to alloc scratch buffer!We are completely uploaded and fine Done waiting for 100-continue transfer closed with %lld bytes remaining to readtransfer closed with outstanding read data remainingNo URL set!Maximum (%ld) redirects followed%15[^?&/:]://%cIssue another request to this URL: '%s' Switch from POST to GET Disables POST, goes with %s Re-used connection seems dead, get a new one Connection died, retrying a fresh connect      OKToo long hexadecimal numberIllegal or missing hexadecimal sequenceMalformed encoding foundWrite errorBad content-encoding found%.*s%sAuthorization: Digest %s getaddrinfo(3) failed for %s:%d   $ ( , 0 4        GMTUTCWETBSTWAT<ASTADTEST,EDTCSThCDT,MSTMDThPSTPDTYSTYDTHSTXHDTCATXAHSTXNTIDLWCETMETMEWTMESTCESTMESZFWTFSTEETWAST\WADT CCT JSTEASTEADTlGSTNZT0NZST0NZDTIDLE0A<BxCDE,FhGHIKXLMNOPLQRST\U VWXlY0Z            ;Zx0N%31[ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz]%02d:%02d:%02d%02d:%02dJanFebMarAprMayJunJulAugSepOctNovDecMondayTuesdayWednesdayThursdayFridaySaturdaySundayMonTueWedThuFriSatSun (Tl lE@Received last DATA packet block %d again. Received unexpected DATA packet block %d, expecting block %d Timeout waiting for block %d ACK. Retries = %d tftp_rx: internal errorset timeouts for state %d; Total %ld, retry %d maxtry %d Connected for receiveReceived ACK for block %d, expecting %d tftp_tx: giving up waiting for block %d acktftp_tx: internal error, event: %iConnected for transmitbind() failed; %s;mode=octetnetascii%s%c%s%c%lldtsizeblksizetftp_send_first: internal errorTFTP finishedInternal state machine errorTFTP response timeoutReceived too short packetMalformed ACK packet, rejectinggot option=(%s) value=(%s) invalid blocksize value in OACK packet%s (%d)blksize is larger than max supportedblksize is smaller than min supported%s (%ld)server requested blksize larger than allocated%s (%d) %s (%d) blksize parsed from OACKrequested%s (%ld) tsize parsed from OACKinvalid tsize -:%s:- value in OACK packetInternal error: Unexpected packetTFTPSOCKS4 communication to %s:%d %hu.%hu.%hu.%huSOCKS4 connect to %s (locally resolved) Failed to resolve "%s" for SOCKS4 connect.Too long SOCKS proxy name, can't use! Failed to send SOCKS4 connect request.Failed to receive SOCKS4 connect request ack.SOCKS4 reply has wrong version, version should be 4.SOCKS4%s request granted. Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected or failed.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because SOCKS server cannot connect to identd on the client.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), request rejected because the client program and identd report different user-ids.Can't complete SOCKS4 connection to %d.%d.%d.%d:%d. (%d), Unknown.SOCKS5: server resolving disabled for hostnames of length > 255 [actual len=%zu] SOCKS5: no connection hereSOCKS5: connection timeoutSOCKS5: error occurred during connectionUnable to send initial SOCKS5 request.SOCKS5 nothing to readSOCKS5 read timeoutSOCKS5 read error occurredUnable to receive initial SOCKS5 response.Received invalid version in initial SOCKS5 response.Failed to send SOCKS5 sub-negotiation request.Unable to receive SOCKS5 sub-negotiation response.User was rejected by the SOCKS5 server (%d %d).SOCKS5 GSSAPI per-message authentication is not supported.No authentication method was acceptable. (It is quite likely that the SOCKS5 server wanted a username/password, since none was supplied to the server on this connection.)No authentication method was acceptable.Undocumented SOCKS5 mode attempted to be used by server.Failed to resolve "%s" for SOCKS5 connect.Failed to send SOCKS5 connect request.Failed to receive SOCKS5 connect request ack.SOCKS5 reply has wrong version, version should be 5.Can't complete SOCKS5 connection to %d.%d.%d.%d:%d. (%d)Can't complete SOCKS5 connection to %s:%d. (%d)Can't complete SOCKS5 connection to %02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%02x%02x:%d. (%d)X p:EX1dCd880.0.-X L<p +O@8D18.%c%03d(){ %*]LIST "%s" *Cannot SEARCH without a query string.SEARCH %sCannot FETCH without a UID.FETCH %s BODY[%s]<%s>FETCH %s BODY[%s]NOBADBad tagged response* CAPABILITYLISTSTOREFETCHSELECTEXAMINESEARCHEXPUNGELSUBNOOP+ Unexpected continuation responseAUTHENTICATE %s %sAUTHENTICATE %sLOGIN %s %sNo known authentication mechanisms supported! IMAPS not supported!Got unexpected imap-server responseSTARTTLSLOGINDISABLEDSASL-IRAUTH=STARTTLS not supported.STARTTLS denied. %cAuthentication cancelledAccess denied. %cOK [UIDVALIDITY %19[0123456789]]Mailbox UIDVALIDITY has changedSelect failedFound %llu bytes to download Written %llu bytes, %llu bytes are left for transfer Failed to parse FETCH response.UIDVALIDITYUIDSECTIONPARTIALCannot APPEND without a mailbox.Cannot APPEND with unknown input file size APPEND %s (\Seen) {%lld}Cannot SELECT without a mailbox.SELECT %s* 4OS$LQNdNXMXMLn@D* L<n* *+ML`MQUITAUTH %s %sAUTH %s-ERR+OKPOP3S not supported!%02xAPOP %s %sUSER %s+APOPRETR . Got unexpected pop3-server responseCAPASTLSUSERSASL STLS not supported.Authentication failed: %dPASS %spopPOP3, e8ntalDcc__<_D, L<P Nc]_VRFYHELPRCPT TO:%sRCPT TO:<%s>localhostSMTPS not supported!Got unexpected smtp-server response: %dEHLO %sHELO %sRemote access denied: %dSIZEAUTH Command failed: %dMAIL failed: %dRCPT failed: %dDATADATA failed: %d<>MAIL FROM:%sMAIL FROM:%s AUTH=%sMAIL FROM:%s AUTH=%s SIZE=%sMAIL FROM:%s SIZE=%s ..SMTPserver response timeoutselect/poll errorresponse reading failedExcessive server response line length received, %zd bytes. Stripping d1 {(}|X|{0|*The CSeq of this request %ld did not match the response %ldGot an RTP Receive with a CSeq of %ld ANNOUNCEAccept: application/sdp GET_PARAMETERSET_PARAMETERRECORDOPTIONSDESCRIBESETUPPLAYPAUSETEARDOWNGot invalid RTSP requestGot invalid RTSP request: RTSPREQ_LASTRefusing to issue an RTSP request [%s] without a session ID.Transport:Transport: %s Refusing to issue an RTSP SETUP without a Transport: header.Range: %s CSeq:CSeq cannot be set as a custom header.Session:Session ID cannot be set as a custom header.%s %s RTSP/1.0 CSeq: %ld Session: %s Content-Type: text/parameters Content-Type: application/sdp Failed sending RTSP requestCannot pause RTPFailed writing RTP dataGot an error writing an RTP packet: %ldUnable to read the CSeq header: [%s]Got RTSP Session ID Line [%s], but wanted ID [%s]Got a blank Session IDRTSP1 FFailed sending Gopher requestGOPHEREstablish HTTP proxy tunnel to %s:%hu CONNECT%s%s%s:%huHost: %s CONNECT %s HTTP/%s %s%s%sFailed sending CONNECT to proxyProxy CONNECT aborted due to timeoutProxy CONNECT aborted due to select/poll errorProxy CONNECT connection closed Proxy CONNECT abortedchunk reading DONE Read %zd bytes of chunk, continue Ignore %lld bytes of response-body %zd bytes of chunk left Proxy CONNECT followed by %zd bytes of opaque data. Data ignored (known bug #39)CONNECT responded chunked HTTP/1.%d %dTUNNEL_STATE switched to: %d Connect me again please Received HTTP code %d from proxy after CONNECTProxy replied OK to CONNECT request 7 7 7 7 D8 7  L8 @7 7 user=%sauth=Bearer %suser=%shost=%sauth=Bearer %suser=%shost=%sport=%ldauth=Bearer %snonce="realm="algorithm=qop="md5-sessauthauth-intauth-conf%08x%08x%08x%08xusername="%s",realm="%s",nonce="%s",cnonce="%s",nc="%s",digest-uri="%s",response=%s,qop=%s00000001AUTHENTICATE%s:%s:%sd41d8cd98f00b204e9800998ecf8427e%s:%s:%08x:%s:%s:%susername="%s", realm="%s", nonce="%s", uri="%s", cnonce="%s", nc=%08x, qop=%s, response="%s"username="%s", realm="%s", nonce="%s", uri="%s", response="%s"%s, opaque="%s"%s, algorithm="%s"noncestalerealmopaqueqopalgorithmMD5-sessMD5LOGINEXTERNALXOAUTH2PLAINOAUTHBEARERCRAM-MD5DIGEST-MD5%s %02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xAQ==Unsupported SASL authentication mechanismGSSAPINTLM./..//.//../WARNING: Using weak random seed 8̿ xPCouldn't open file %sCan't open %s for writingCan't get the size of %sAccept-ranges: bytes Last-Modified: %s, %02d %s %4d %02d:%02d:%02d GMT Can't get the size of file.failed to resume file:// transferABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_%c%c==%c%c%c=; ; ; ; < ; D < < < (< 0< ------------------------%08x%08x; filename="%s"application/octet-streamContent-Type: multipart/form-data%s; boundary=%s --%s Content-Disposition: form-data; name=" Content-Type: multipart/mixed; boundary=%s --%s Content-Disposition: attachment Content-Type: %s %scouldn't open file "%s" --%s-- --%s-- .gifimage/gif.jpgimage/jpeg.jpegtext/plain.htmltext/html.xmlapplication/xmlEPSVPASVEPRTPORTI $+ 0hfI L<SSLTLSAccept-ranges: bytes PBSZ %dFailure sending QUIT command: %sftp server doesn't support SIZE Offset (%lld) was beyond file size (%lld)File already completely downloaded Instructs server to resume from offset %lld REST %lldRETR %sConnect data stream passively APPE %sSTOR %sSIZE %sFailed to read dataFile already completely uploaded getsockname() failed: %sfailed to resolve the address provided to PORT: %sbind(port=%hu) on non-local address failed: %s bind(port=%hu) failed: %ssocket failure: %s%s |%d|%s|%hu|Failure sending EPRT command: %s,%d,%dFailure sending PORT command: %sbind() failed, we ran out of ports!Error accept()ing server connectConnection accepted from server Doing the SSL/TLS handshake on the data stream no memoryUploading to a URL without a file name!Request has same path as previous transfer FTPS not supported!ACCT %sACCT requested but none availableAccess denied: %03dFailed EPSV attempt, exiting Failed EPSV attempt. Disabling EPSV PASV%c%c%c%u%cIllegal port number in EPSV replyWeirdly formatted EPSV reply%d,%d,%d,%d,%d,%dCouldn't interpret the 227-responseSkip %d.%d.%d.%d for data connection, re-use %s instead Bad PASV/EPSV response: %03dCan't resolve proxy host %s:%huCan't resolve new host %s:%huConnecting to %s (%s) port %d TYPE %cMDTM %sCWD %sNLSTPRET %sPRET STOR %sPRET RETR %sREST %dFTP response timeoutFTP response aborted due to select/poll error: %dWe got a 421 - timeout! Checking for server connect Accept timeout occurred while waiting server connectThere is negative response in cache while serv connect Error while waiting for server connectReady to accept data connection from server Ctrl conn has data while waiting for data conn Preparing for accepting server on data port Connection to proxy confirmed unknown proxytype option givenGot a %03d ftp-server response when 220 was expectedunsupported parameter to CURLOPT_FTPSSLAUTH: %dACCT rejected by server: %03dPROT %cCCCFailed to clear the command channel (CCC)SYSTEntry path is '%s' Failed to figure out path OS/400SITE NAMEFMT 1QUOT command failed with %03dMKD %sServer denied you to change to the given directoryFailed to MKD dir: %03d%04d%02d%02d%02d%02d%02d%04d%02d%02d %02d:%02d:%02d GMTunsupported MDTM reply format Given file does not existSkipping time comparison Couldn't set desired modeGot a %03d response code instead of the assumed 200 Couldn't use RESTPRET command not accepted: %03ddisabling EPRT usage Failed to do PORTConnect data stream actively Maxdownload = %lld Getting file with size: %lld Data conn was not available immediately RETR response: %03dFailed FTP upload: %0dWildcard - Parsing started Wildcard - START of "%s" Wildcard - "%s" skipped by user ftp_perform ends with SECONDARY: %d Remembering we are in dir "%s" ABORFailure sending ABOR command: %scontrol connection looks deadpartial download completed, closing connection server did not report OK, got %dUploaded unaligned file size (%lld out of %lld bytes)Received only partial file: %lld bytesNo data was received!QUOT string not accepted: %sFTP -> total rwx-tTsS0123456789-APM0123456789:

QSQQSQ@6\alnumalphaxdigitprintgraphspaceblankupperlowerdigitout of memory garbage collected wiringX library%s: error while calling pinMode%s: platform doesn't support pinMode%s: error while calling analogRead%s: platform doesn't support analogRead%s: error while calling digitalWrite%s: platform doesn't support digitalWrite%s: error while calling digitalRead%s: platform doesn't support digitalRead%s: error while calling waitForInterrupt%s: platform doesn't support waitForInterrupt%s: error while calling isr%s: platform doesn't support isr%s: error while calling I2CRead%s: platform doesn't support I2CRead%s: error while calling I2CReadReg8%s: platform doesn't support I2CReadReg8%s: error while calling I2CReadReg16%s: platform doesn't support I2CReadReg16%s: error while calling I2CBlockRead%s: platform doesn't support I2CBlockRead%s: error while calling I2CBlockReadReg8%s: platform doesn't support I2CBlockReadReg8%s: error while calling I2CBlockReadReg16%s: platform doesn't support I2CBlockReadReg16%s: error while calling I2CWrite%s: platform doesn't support I2CWrite%s: error while calling I2CWriteReg8%s: platform doesn't support I2CWriteReg8%s: error while calling I2CWriteReg16%s: platform doesn't support I2CWriteReg16%s: error while calling I2CBlockWrite%s: platform doesn't support I2CBlockWrite%s: error while calling I2CBlockWriteReg8%s: platform doesn't support I2CBlockWriteReg8%s: error while calling I2CBlockWriteReg16%s: platform doesn't support I2CBlockWriteReg16%s: error while calling I2CSetup%s: platform doesn't support I2CSetup%s: error while calling SPIGetFd%s: platform doesn't support SPIGetFd%s: error while calling SPIDataRW%s: platform doesn't support SPIDataRW%s: error while calling SPISetup%s: platform doesn't support SPISetupUnsupported data sizeUnsupported parityUnsupported data stop bitsUnsupported data flow controlSerial interface is not opened%s: platform doesn't support gpio number validationrunning on a %shardware not supported54    5454      /sys/class/gpio/gpio%d/value/sys/class/gpio/unexportbananapi->gc: Unable to open GPIO unexport interface: %sbananapi->waitForInterrupt: Invalid pin number %dbananapi->waitForInterrupt: Trying to read from pin %d, but it's not configured as interruptbananapi->waitForInterrupt: GPIO %d not set as interruptbananapi->identify: Unable open /proc/cpuinfoHardwarebananapi->identify: /proc/cpuinfo has no hardware linesun7isun4ibananapi->digitalRead: Invalid pin number %dbananapi->digitalRead: Trying to write to pin %d, but it's not configured as inputbananapi->digitalWrite: Invalid pin number %dbananapi->digitalWrite: Trying to write to pin %d, but it's not configured as outputbananapi->pinMode: Invalid pin number %d/dev/i2c-2/dev/i2c-3bananapi->I2CSetup: Unable to determine Pi board revisionbananapi->I2CSetup: Unable to open %sbananapi->I2CSetup: Unable to set %s to slave modebananapi->setup: Unable to open /dev/membananapi->setup: mmap (GPIO) failedfallingrisingbothbananapi->isr: Invalid pin number %dbananapi->isr: Invalid mode. Should be INT_EDGE_BOTH, INT_EDGE_RISING, or INT_EDGE_FALLINGbananapi->isr: Invalid pin number: %d/sys/class/gpio/exportbananapi->isr: Unable to open GPIO export interface/sys/class/gpio/gpio%d/directionbananapi->isr: Unable to open GPIO direction interface for pin %d: %sin /sys/class/gpio/gpio%d/edgebananapi->isr: Unable to open GPIO edge interface for pin %d: %snone rising falling both bananapi->isr: Invalid mode: %s. Should be rising, falling or bothbananapi->isr: Unable to open GPIO value interface: %sbananapi->changeOwner: File not present: %sbananapi->changeOwner: Unable to change ownership of %s: %sbananapi->isr: Failed to set interrupt edge to %sbananapin DG  Cdj5454       orangepi->pinMode: Invalid pin number %dorangepi->pinMode: Pin = %dorangepi->gc: Unable to open GPIO unexport interface: %sorangepi->waitForInterrupt: Invalid pin number %dorangepi->waitForInterrupt: Trying to read from pin %d, but it's not configured as interruptorangepi->waitForInterrupt: GPIO %d not set as interruptorangepi->identify: Unable open /proc/cpuinfoorangepi->identify: /proc/cpuinfo has no hardware linesun8iorangepi->digitalRead: Invalid pin number %dorangepi->digitalRead: Trying to write to pin %d, but it's not configured as inputorangepi->digitalWrite: Invalid pin number %dorangepi->digitalWrite: Trying to write to pin %d, but it's not configured as outputError writing %i bytes Error setting pointer Error reading %i bytes orangepi->I2CSetup: Unable to determine Pi board revisionorangepi->I2CSetup: Unable to open %sorangepi->I2CSetup: Unable to set %s to slave modeorangepi->setup: Unable to open /dev/memorangepi->setup: mmap (GPIO) failedorangepi->isr: Invalid pin number %dorangepi->isr: Invalid mode. Should be INT_EDGE_BOTH, INT_EDGE_RISING, or INT_EDGE_FALLINGorangepi->isr: Invalid pin number: %dorangepi->isr: Unable to open GPIO export interfaceorangepi->isr: Unable to open GPIO direction interface for pin %d: %sorangepi->isr: Unable to open GPIO edge interface for pin %d: %sorangepi->isr: Invalid mode: %s. Should be rising, falling or bothorangepi->isr: Unable to open GPIO value interface: %sorangepi->changeOwner: File not present: %sorangepi->changeOwner: Unable to change ownership of %s: %sorangepi->isr: Failed to set interrupt edge to %sorangepi@ @ @ @ @ @ @ IHGFChummingboard->pinMode: Please run wiringXSetup before running pinModehummingboard->pinMode: Invalid pin number %dhummingboard->pinMode: Pin modes can only be OUTPUT or INPUThummingboard->SPIDataRW: Unable to read/write from channel %d: %s/dev/spidev1.0/dev/spidev1.1hummingboard->SPISetup: Unable to open %s: %shummingboard->SPISetup: Unable to set %s to write mode: %shummingboard->SPISetup: Unable to set %s to read mode: %shummingboard->SPISetup: Unable to set %s write bits_per_word: %shummingboard->SPISetup: Unable to set %s read bits_per_word: %shummingboard->SPISetup: Unable to set %s write max_speed: %shummingboard->SPISetup: Unable to set %s read max_speed: %shummingboard->gc: Unable to open GPIO unexport interface: %shummingboard->identify: Unable open /proc/cpuinfoRevisionhummingboard->identify: /proc/cpuinfo has no hardware and revision lineHardware%*[ ]:%*[ ]%[a-zA-Z0-9 ./()]%*[ ]Freescale i.MX6SolidRun i.MX6HummingBoardhummingboard->digitalWrite: Trying to write to pin %d, but it's not configured as outputhummingboard->digitalWrite: Invalid pin number %dhummingboard->digitalRead: Trying to write to pin %d, but it's not configured as inputhummingboard->digitalRead: Invalid pin number %dhummingboard->I2CSetup: Unable to open %s: %shummingboard->I2CSetup: Unable to set %s to slave mode: %shummingboard->waitForInterrupt: Trying to read from pin %d, but it's not configured as interrupthummingboard->setup: Unable to open /dev/mem: %shummingboard->setup: mmap (GPIO) failed: %shummingboard->isr: Invalid pin number %dhummingboard->isr: Invalid mode. Should be INT_EDGE_BOTH, INT_EDGE_RISING, or INT_EDGE_FALLINGhummingboard->isr: Unable to open GPIO export interface: %shummingboard->isr: Unable to open GPIO direction interface for pin %d: %shummingboard->isr: Unable to open GPIO edge interface for pin %d: %shummingboard->isr: Invalid mode: %s. Should be rising, falling or bothhummingboard->isr: Unable to open GPIO value interface: %shummingboard->changeOwner: File not present: %shummingboard->changeOwner: Unable to change ownership of %s: %shummingboard->isr: Failed to set interrupt edge to %shummingboard }| !"#-*+,98Z[YX~/'$&%   !"#radxa->digitalRead: Invalid pin number %dradxa->digitalRead: The onboard LEDs cannot be used as inputradxa->digitalRead: Trying to write to pin %d, but it's not configured as inputradxa->digitalWrite: Invalid pin number %dradxa->digitalWrite: Trying to write to pin %d, but it's not configured as output/proc/versionradxa->identify: Unable open /proc/version%*[^0-9]%d.%d.%dradxa->identify: Kernel version cannot be determined.radxa->identify: Kernel version is %d.%d.%d.radxa->gc: Unable to open GPIO unexport interface: %s/dev/spidev0.0/dev/spidev0.1radxa->SPISetup: Unable to open device %s: %sradxa->SPISetup: Unable to set write mode for device %s: %sradxa->SPISetup: Unable to set read mode for device %s: %sradxa->SPISetup: Unable to set write bits_per_word for device %s: %sradxa->SPISetup: Unable to set read bits_per_word for device %s: %sradxa->SPISetup: Unable to set write max_speed for device %s: %sradxa->SPISetup: Unable to set read max_speed for device %s: %sradxa->SPIDataRW: Unable to read/write from channel %d: %sradxa->waitForInterrupt: Invalid pin number %dradxa->waitForInterrupt: The onboard LEDs cannot be used as interruptsradxa->waitForInterrupt: Trying to read from pin %d, but it's not configured as interruptradxa->waitForInterrupt: GPIO %d not set as interruptradxa->identify: Unable open /proc/cpuinforadxa->identify: /proc/cpuinfo has no hardware lineRK30boardRockchipradxa->I2CSetup: Unable to determine Pi board revisionradxa->I2CSetup: Unable to open %sradxa->I2CSetup: Unable to set %s to slave moderadxa->pinMode: Invalid pin number %dradxa->pinMode: The onboard LEDs cannot be used as inputradxa->isr: Invalid pin number %dradxa->isr: The onboard LEDs cannot be used as interruptsradxa->isr: Invalid mode. Should be INT_EDGE_RISING, INT_EDGE_FALLING, or INT_EDGE_BOTHradxa->isr: Unable to open GPIO export interfaceradxa->isr: Unable to open GPIO direction interface for pin %d: %sradxa->isr: Unable to open GPIO edge interface for pin %d: %sradxa->isr: Could not set interrupt mode to %sradxa->isr: Unable to open GPIO value interface: %sradxa->changeOwner: File not present: %sradxa->changeOwner: Unable to change ownership of %s: %sradxa->isr: Failed to set interrupt edge to %sradxaRK3188-GPIOgpio0gpio1gpio2gpio3|z{}~ci20->SPIDataRW: Unable to read/write from channel %d: %sci20->SPISetup: Unable to open device %s: %sci20->SPISetup: Unable to set write mode for device %s: %sci20->SPISetup: Unable to set read mode for device %s: %sci20->SPISetup: Unable to set write bits_per_word for device %s: %sci20->SPISetup: Unable to set read bits_per_word for device %s: %sci20->SPISetup: Unable to set write max_speed for device %s: %sci20->SPISetup: Unable to set read max_speed for device %s: %sci20->gc: Unable to open GPIO unexport interface: %sci20->waitForInterrupt: Invalid pin number %dci20->waitForInterrupt: Trying to read from pin %d, but it's not configured as interruptci20->waitForInterrupt: GPIO %d not set as interruptci20->identify: Unable open /proc/cpuinfoCI20ci20->I2CSetup: Unable to open %s: %sci20->I2CSetup: Unable to set %s to slave mode: %sci20->setup: Unable to open /dev/memci20->setup: mmap (GPIO) failedci20->isr: Invalid pin number %dci20->isr: Invalid mode. Should be INT_EDGE_BOTH, INT_EDGE_RISING, or INT_EDGE_FALLINGci20->isr: Unable to open GPIO export interface: %sci20->isr: Unable to open GPIO direction interface for pin %d: %sci20->isr: Unable to open GPIO edge interface for pin %d: %sci20->isr: Invalid mode: %s. Should be rising, falling or bothci20->isr: Unable to open GPIO value interface: %sci20->changeOwner: File not present: %sci20->changeOwner: Unable to change ownership of %s: %sci20->isr: Failed to set interrupt edge to %sci20       raspberrypi->digitalWrite: Trying to write to pin %d, but it's not configured as outputraspberrypi->digitalWrite: Invalid pin number %draspberrypi->pinMode: Invalid pin number %draspberrypi->SPIDataRW: Unable to read/write from channel %d: %sraspberrypi->SPISetup: Unable to open device %s: %sraspberrypi->SPISetup: Unable to set write mode for device %s: %sraspberrypi->SPISetup: Unable to set read mode for device %s: %sraspberrypi->SPISetup: Unable to set write bits_per_word for device %s: %sraspberrypi->SPISetup: Unable to set read bits_per_word for device %s: %sraspberrypi->SPISetup: Unable to set write max_speed for device %s: %sraspberrypi->SPISetup: Unable to set read max_speed for device %s: %sraspberrypi->gc: Unable to open GPIO unexport interface: %sraspberrypi->waitForInterrupt: Invalid pin number %draspberrypi->waitForInterrupt: Trying to read from pin %d, but it's not configured as interruptraspberrypi->waitForInterrupt: pin %d set as interrupt but not attached to hardwareraspberrypi->identify: Unable open /proc/cpuinfoBCM2708raspberrypi->identify: Unable to open /proc/cpuinforaspberrypi->identify: No "Revision" lineraspberrypi->identify: No numeric revision stringraspberrypi->identify: Bogus "Revision" line (too small)00020003BCM2709/dev/i2c-1raspberrypi->I2CSetup: Unable to determine Pi board revisionraspberrypi->I2CSetup: Unable to open %s: %sraspberrypi->I2CSetup: Unable to set %s to slave mode: %sraspberrypi->setup: Unable to open /dev/mem: %sraspberrypi->setup: mmap (GPIO) failed: %sraspberrypi->digitalRead: Trying to write to pin %d, but it's not configured as inputraspberrypi->digitalRead: Invalid pin number %draspberrypi->isr: Invalid pin number %draspberrypi->isr: Invalid mode. Should be INT_EDGE_NONE, INT_EDGE_BOTH, INT_EDGE_RISING, or INT_EDGE_FALLINGraspberrypi->isr: Unable to open GPIO export interface for pin %d: %sraspberrypi->isr: Unable to open GPIO direction interface for pin %d: %sraspberrypi->isr: Unable to open GPIO edge interface for pin %d: %sraspberrypi->isr: Invalid mode: %s. Should be rising, falling or bothraspberrypi->isr: Unable to open GPIO value interface: %sraspberrypi->changeOwner: File not present: %sraspberrypi->changeOwner: Unable to change ownership of %s: %sraspberrypi->isr: Failed to set interrupt edge to %sraspberrypi؜11q  ,# , 0 op  8 0(oDoo8 8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#8#UqFfFFFuͶf͐uiYُmFmd9u`ݵF< 20 02@ 4AP\D2`t3|220L38`3h @T 5 LT 5  XT 5 \ dT 5 d8 5 S 5 S 5 7 5 8 5 H2 5 b F 5 <6p4> `@ @O 5 O 5 ' P 5 t5 ,P 5 Dl@Hd\8l|`8BBX^ G70Bh98W<Tl7\xh7W8:8; 6887<T<7Xp7x7p7;\ 5 ] 5 ^$@7,3,4/dev/model_id|/dev/model_subid/dev/para/ip/dev/para/uartport/dev/para/baudrate/dev/para/cc_addr/dbgAct/act/para/oop5 D6 `6 |6 8 6 (6 8 8 8 5 5 6 (6 D6 `6 |6 6 6 6 6  6 6 7 7 87 P7 h7 7 7 7 7 7 7 6 6 8 8 08 (6 6 <8 6 6 D8 6 6 8 8 L8 6 6 T8 6 \8 6 6 d8 6 6 8 l8 6 t8 6 |8 6 8 6 6 8 8 A! ! ! 4 } ! ! " " " " " A " ! ! 4 } ! ! " " " " " A0" ! @" P" } T" ! " " \" d" " Al" ! |" 4 " } " ! ! " " " " " " " " A" ! " # ' T" ! " " # # " B# (# 0# 4 8# D# P# x } X# X# | \#    d# l# t# # # B% (# 0# 4 8# D# } X# X#    % % % # & C ' ' $' 4 } `1 X' 4' " " " D@' L> @ P" } P' T' 4' " " " \' Dd' L> t' 4 }   ' ' ' ' ' " ' ' ' ' " " ' D' L> t' 4 }   ' ' ' ' ' " ' ' ' ' " " ' D' L> t' P" }   ' ' ' ' ' " ' ' ' ' \" d"  D' L> t' ' ( ( 4 " " " }   ' ' ' ' ' " ' ' ' ' " " ' ( D( L> t' ) $) )   ' ' ' ' ' " ' ' ' ' ) ) () D0) L> t' 4 }   ' ' ' ' ' " ' ' ' ' " " ' D <) L> t' L) X) " "   ' ' ' ' ' " ' ' ' ' d) d) () D l) L> t' |) ) ) )   ' ' ' ' ' " ' ' ' ' d) d) () D ) L> t' |) ) ) )   ' ' ' ' ' " ' ' ' ' d) d) () D ) L> t' |) )   ' ' ' ' ' " ' ' ' ' d) d) () D ) L> t' |) ) ) )   ' ' ' ' ' " ' ' ' ' d) d) ) D) L> t' |) ) ) )   ' ' ' ' ' " ' ' ' ' d) d) ) D) L> t' |) ) ) )   ' ' ' ' ' " ' ' ' ' d) d) ) D) L> t' 4 }   ' ' ' ' ' " ' ' ' ' d) d) ' E) * P" } ! * " * " " " E@* L* 4 } X* $! " " " " " E`* L* 4 " } " X* $! " " " " " El* L* P" |* } " X* $! " " \" d" " * E* L* 4 8# * P# D# } X# \# * X# X* $! " " " * E- L* 4 * P# } - $- X* $! " " " (- E. L* 4 8# D# } X# X# X* $! " " " . F/ / / / / / / / / / / " F/ / / |) ) '  0   " @/ / /  0 5 5 b b " G0 ,0 40 P" } G D0 P0 T" \0 h0 t0 \" d" |0 G0 0 40 P" } G D0 P0 T" \0 0 0 \" d" |0 G0 0 40 P" } G D0 P0 T" \0 h0 0 \" d" |0 G0 0 40 P" } G D0 P0 T" \0 h0 0 \" d" |0 H0 0 40 4 }  G D0 P0 T" 0 0 h0 0 " " 0 I1 1 1  1  0 " ,pp() $1 b 01 " 81 " D1 d" P1 I\1 1 1 4 } p1 " x1 x1 () I1 1 1 4 P# 8# x 1 1 / } 1 X# \# } ) p1 1 " " 1 1 " I1 1 1 |) ) p1 1 " 1 1 1 " I1 1 1 4 } '   " " " 1 " d) d) # 1 IL2 1 1 4 } '   " " " T2 " " " # \2 I2 1 1 4 2 } } '   " " " 2 2 2 2 I3 1 1 4 3 } 3 '   " " " " " # 3 I|4 1 1 " 4 " } '   " " " 4 4 4 P|B 4 " # 3 I4 1 1 ' ( ( 4 4 4 4 4 " " " }  " " " '   " " " 4 " # 3 I4 1 1 P" } '   " " " \" d" 4 3 I4 1 5  8z  5 P0 5 5 Q 0" " " " (5 45 " <5 H5 H5 4 3 I4 1 5  8z P5 P0 5 5 Q 0" " " " (5 45 " <5 H5 H5 4 3 Je\5 1 l5 x5 |5 5 D# 5 5 5 " " " " " " "    " " " 5 5 4 3 J5 5 l5 8 5 5 5 / / / / /    " " " 5 5 4 3 5 5 8 9  9 49 H9 d9 |9 9 9 9 9 9  |C C " " 4 } C C " " 4 } C C \" d" P" } C C " " ' ( ( 4 " " " } ^C D " " ' ( ( 4 " " " }  D D ) ) ) $) )  0D 0D " " 4 } DD TD d) d) L) X) " " (pD |D d) d) |) ) ) ) *D D d) d) |) ) ) ) +D D d) d) |) )  D D d) d) |) ) ) ) ,E E d) d) |) ) ) ) (E 4E d) d) |) ) ) ) HE TE d) d) 4 } Q/dev/model_id/dev/model_subid /dbgAct/act/dev/para/sn/dev/para/gw_type /info/name($/para/oo,(/para/oop0,/para/unlock40/para/hue84/para/satHD/para/lig@<hE lE tE ,X` %K$ @8noe@ N' q9i5/dev/model_id/dev/model_subid/dbgAct/act/dev/para/_snid/dev/para/_index/dev/para/_id/dev/para/_subid/dev/para/_contact/dev/para/_local_sn/dev/para/port_rs485/dev/para/port_rs232 /dev/para/baudrate/dev/para/databit /dev/para/stopbit($/dev/para/parity0,/alt_tag/data_type84/alt_tag/data_s@</alt_tag/volt_lbHD/alt_tag/volt_ubPL/alt_tag/volt_pwrXT/info/name/para/execD@/para/action/para/oo/para/fan_a/para/temp_set/para/cond_opa/para/auto_wind/para/wind_dir/para/rename/para/oop`\/para/brid`/para/huelh/para/sattp/para/lig|x/para/c_mode/para/c_level/para/w_level/para/h_vQ &Q 3Q @Q MQ ZQ flQ tQ |Q Q Q Q Q Q Q Q Q Q Q R Q 5  Q Q Q $Q ,Q 4Q  D P ` d l |  /dev/vendor<&/dev/contact8&/dev/model_id|&/dev/model_subid&/dev/para/dm_off&/dev/para/gw_ip&/dev/para/unit_addr&/dev/para/cc_addr&/para/oo&&/para/oop&/para/bri&@AA@A@@AA@@A@AA@A@@A@AA@@AA@A@@AA@@A@AA@@AA@A@@A@AA@A@@AA@@A@AA@  01326754<=?>:;98()+*./-,$%'&"#! `acbfgedlmonjkihxy{z~}|tuwvrsqpPQSRVWUT\]_^Z[YXHIKJNOMLDEGFBCA@; $ |  &@$T%0%X#8 0@   54    nDG  \  ` @  (  0  8           GCC: (crosstool-NG crosstool-ng-1.22.0-88-g8460611) 4.9.3GCC: (crosstool-NG linaro-1.13.1-4.8-2014.01 - Linaro GCC 2013.11) 4.8.3 20140106 (prerelease)GCC: (Raspbian 4.9.2-10) 4.9.2GCC: (Debian 4.9.2-10) 4.9.2A4aeabi*7-A A  "PLHL<,H!x \  P/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/lib1funcs.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1PL/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/lib1funcs.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1(bL/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/ieee754-df.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1<L/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/bpabi.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1PzL/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/bpabi.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1d /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/lib1funcs.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1xd,intC ]d^V%,aPQ%  ; dH2intC ,d^V%|Ha|HhiLlo \dFx#<a#b$%'PQ(/RS!PQ! 0/!L<)a/!$b0!L1)3!PQdIRS!PQ! ! 'I ! ! !mY\_intC  3,]%^Vlowyy s ll   n d rp q r y lz1 lz2 i k'\utvcyuuvvw@9/h%DNXAbinz+intC ,%^V&ndrp&qrylz1ylz2yiyky  n0 dx   5AlQ/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/lib1funcs.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1e~ /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/lib1funcs.S/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgccGNU AS 2.25.1%%%%%%% $ > $ > : ; I.?: ;'I@B: ;IB1B 1 .?: ; n'I< I% $ > $ > : ; I.?: ;'I@B: ;I4: ;I4: ;I &I% $ > .?: ; 'I@B: ; I: ; I4: ; I1B  I .?: ; 'I< I .?: ; 'I<% $ > $ > : ; I : ; : ;I8  : ;I8  : ; : ;I : ;I .: ;'I  : ;I 4: ;I I.?: ;'I@B: ;I4: ;I1RUX Y1 1 U41% $ > $ > : ; I.: ;'I : ;I4: ;I I .?: ;'I@B : ;I 1RUX Y 1 1 U4141%%u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armlib1funcs.S0/////0./1//0L/2f///////u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armlib1funcs.SP/00///0////0.0/00/10//0L/0/2///////v /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armieee754-df.SL/361//00////2/0////////301////3/1///3/3/21///////////0//2/5//3///1///1//50////2/////.0//0/3///2////20/5/20//2////1/////2/////2//3/0///20/00/10//02//1///0//0//2/// .0//0//0/// .0/////2/60/////02/6///0///00/1////6000/3000/3/1/ ./1/0/0/0//////q /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armbpabi.SZ31////q /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armbpabi.SL31////u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armlib1funcs.S ///u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcclibgcc2.clibgcc2.h /h+0u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcclibgcc2.clibgcc2.h 231x.O2*Nq /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armbpabi.c%./4./u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcclibgcc2.clibgcc2.h z.1300LI/}JJ} J0/myJoJJ0/e/1LQgLNKKMu /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcclibgcc2.clibgcc2.h }J.}J0/yJoJJ0/e/1LQgLNKNJu /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armlib1funcs.S //////u /home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/armlib1funcs.S ////// |  | P | @Ht | hL<h | ,L | H | <BL<B | $(\D(  | `F long long int__fixdfdiDFtype/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-cc-gcc-final/arm-linux-gnueabihf/libgcccomplex doubleUDItypelong long unsigned int__aeabi_d2ulzunsigned char__fixunsdfdi/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/libgcc2.cshort unsigned intcomplex floatGNU C 4.9.3 -march=armv6 -mfloat-abi=hard -mfpu=vfp -mtls-dialect=gnu -g -g -g -Os -O2 -Os -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fvisibility=hiddenshort intsizetypeUSItype__divdi3__gnu_uldivmod_helper/home/dom/projects/crosstool-ng/install/bin/.build/src/gcc-4.9.3/libgcc/config/arm/bpabi.cremainderquotient__gnu_ldivmod_helper__udivdi3high__udivmoddi4DWunionGNU C 4.9.3 -march=armv6 -mfloat-abi=hard -mfpu=vfp -mtls-dialect=gnu -g -g -g -Os -O2 -Os -fbuilding-libgcc -fno-stack-protector -fPIC -fno-inline -fexceptions -fvisibility=hiddenDWstructPQ%PQ,%PQ$NO$H%$N%L,%%A,$H%L,%%A,PQ<!RS<!<SPQSx!<SRSSx!$PQ$\%@RS@\% 0 4 4\Zd|WVH\WV\^\H\^\HTPQX\PQhlPQhTUh (PQ(HVWHTPQhTUTU TU(TU(H %{,%%hlPQHXYYq( /0@K$( 1$#/p( /0@K$( 1$#/tq0)(q0.(# SWw(WWH[@PQ@%PQ%HRSH%RSHRSH%RSpTUTU PQXYPQ PQpTUTUTUTU %w,%%TUHRSH`%`XYRS8DQKpt( /0@K$( 1$#/uu0)(# t( /0@K$( 1$#/uu0)(u0)(( /0@K$( 1$#/t( /0@K$( 1$#/uu0)(# t( /0@K$( 1$#/uu0)(u0)(u0.(VvV<VWPXhH.symtab.strtab.shstrtab.interp.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.init_array.fini_array.jcr.dynamic.got.data.bss.comment.ARM.attributes.debug_aranges.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.debug_loc.debug_ranges4PpD ,# 8# +   ( , 0 4 8 8 L   !nPq0 n n(1 nnL 41 Q41 nP1 ,#  ^4#  ( (   n@ L n ľ n4 8 n  n  n  n  Dd n  $ nP T n  n, 0 n\ d n  nl p n  n +  + n0+ ( n  n  n  n  n  n  n( , ,$ n0 P np t n  n  nL T n  n  n  n 8 n  L n  $d nX ` n ( n` h n  nD T n  nx  nH \ n , n  n ( n  n  n  n` | n  n  n  n  n  nT d nH \ n  n  n4  <  n   n    n   n    nX  `  n   n    n   n    n 4 n  n , n  n$ ( nx  n  n  n  n0 4 nX d n  n  nP X n  n  nP d n  n  n  n  nT ` n|  n  n  n 0 nh l n  n  n  nH T n  n4 8 nP X np x n  n , n  4  n   n" " n# # n$ $ n$& 0& n' ' n( ) n* * nX, h, n, - n- - nT. n 8 A, T< fD yX d t       Ќ ܌ 1 D W j } , 8 @ L X h x  ( ; `H V4 i@ |P nL n\ n$$$$ %$%(%xd.  n    n    L ,D n$ < nt | >|l n  U@ n$ ( m( n  nP T nD X n  n` p n  n  n  n  n  8+ {8+ n+ n  n, L n  nP  n  n  h n( 0 0 + +X 4L nx   nx   nl p p, P- n. . .l nx. |. |.| 7 Ot n  ] P n  n,! 0! nX" |" n\# p# n43 3 nA A A nB B B n8D HD nE E nF F nH H ndJ tJ n<[ \ n`s s n  ,0 0` Dn 5 2 n,2 02 n@2 D2 n|2 2 n2 2 n@3 L3 n3 4 nl4 p4 n\5 x5 n6 <6 n6 6 n,7 87 nd7 h7 n7 7 $74 n8 8 nL8 \8 n8 8 n8 9 n\9 h9 n9 9 nh: : n; 8; n; ; n@< D< D<@ nL> > > n0@ `@ n A 4A n(B 0B nB B nB B nB B nC $C npC C nC C nF F n|F F nG G nG G nG G nG G nH H nPI XI nJ J nJ J nHK PK n$L 8L n8M PM n0N HN nN N nO O nO O nO P n(P ,P nTP XP nxQ Q nR R nS S nS S n0T @T nHT LT nTT XT n`T dT nlT pT nT T nT T nV V nW W n,\ \ n] ^ nD_ p_ n ` . n0 @` n` ` n,a n! 4FXj }     , < L!\3lFX j|        ,  8 yD 0 T C dV xi  nT nn |    H  L  L        4  8 $ P 5 @ 4 X1 M X1 n|1 1 b 1 n1 nP 1 u 1 n1 n0  0 1 1 n2 n,  , n  8a n|b b nc d nd d ne e e ne e ne e nf f nHf Tf nf f nf g ng g nh h nk l nl l nHm Xm nm m nLn `n ntn xn n o o no o no p ntp |p np p n|q q n r 0r nlr tr nTs |s ns s ns s nt t nhw w ny z nTz Xz nz z n{ { n l n  n Ѐ n 4 n  n  nt  n̎  nȐ $ n\  n  n @ n  n  n ؙ n , n, D nT X n  n  n  n   n  n  | n ̤ n< P nT x n, H n  nD  n  n( 8 nL  n n * = P c  v     ,  8 H \ p    3 F  Y l      0 D T  ` h * t=  P  c v         n n0nT  T    &0ķ?ȷNз]س gس` n 8 n n@ w@ P n  |,n0< nĶ n  n  n  n  np  n  n  n  n  n@ L n  nh t n  n ( nX \ n  n0 4 n  n  n  n , n  n( D n  n  n  n 0 n  n  @ n  n  n4 < n  n  n  nl  n< T n  n  n $ n  n  nL P n  n  n  n  n @ n $ n  n, @ n  n< @ n  n  n  n  n  n  n$ ( n4 8 nD H n  n  nd h n( L n   n  n  n  n  L n  n  nt  n  n  n $ n  n  n  nh l n  n` d n  n  h n  nd t n$ < n  P  n   nH  n  $ n`  n  n  n  n   n! ! n* P+ n, , n- (- n- - n. . n/ / n0 0 n2 2 n3 3 nD4 X4 n4 4 n4 n( ( 8 L ` t ) < O b u       0 @ P  `  p 0  3 3 F Y l    ( 8 H X h  * = P c v      , nܟ n0nx4 4X n(6 46 46< nL8 p8 n8 8 n 9 9 nH@ @ n@ @ nA A nC C nC C nD D n F  > n@ @ nHC XC nC C nC C nD D nE E nE F nF F n4G HG nG G nH H nH H nI I nHJ \J nJ K nK L nTM dM nN (N n$P LP ntQ Q nR R nW 0m ~ P  b , t <  P  h  |    ą n    0!ndn!!!!h. !!h. nh/ |/ n(1 1 n3 n 1! C!ț X!ܛ n  @,8&j!8 n0< n%q!%z!&!3 nt4 x4 n< !4 n4 6 n8 L: !; n(< 8< nD< H< n= ,= n> > nh? ? nA B n0C HC nXC \C n G (G n4G 8G nDG HG nI 0I !0I nI I nXJ \J nJ J nJ J nL n ! ! ! !( !8 "L "` t +" =" n< O"< \"D n n.e".p".}",/"L "L$ "M, nO O n4 "4 n< "Q n@R nT "LR nR R nS S n "S nTT n "XT "XT #VX nDZ PZ #PZ n(` L` "#L` nd $d 1#$d| n|k k nm m no o n`p dp n q q nȁ  nЊ Ԋ n ċ n`  n  nܔ n ># xR# n  n$ ( nL P nȘ ؘ n  n | nT  n   n  n| nd \#d h#d u# &n # nP n # >#4 >#t @# @#X #X n( L #L n  #  n  n  nl t n  n  n  n n$ #$ t# t# x$ x$ $| x)$ 2$ LnL ?$L M$` [$t j$ n  n  nT n r$( nd p n, < n |$ $D n@ D nL P n  n $ $ n  n $  n n  n  0 n  n  n8 < n  n@+ $T+ $T+p n+ + n(, H, n, , n,- 0- n- - n/ / nP1 \1 n1 1 n|2 2 n nX nD/$D/$H/$d3 $d3 $|3l %3 n4 4 np5 t5 n(8 88 n8 8 nx9 |9 %:T nB C %C npG G nH n )%H 1%H< nH H 8%H nH H E%H T%H \% I k%I n I $I }%$I nI I %I nJ J %J %tK %LL nxL L %LM nQ Q nhR R nR R nS S n,W 8W nX X nY Y n[ [ n \ $\ n] ] n\_ h_ nd` l` nc c %c` n,d xd nr r nHt Lt &Lt8 nv v n\ &\ L&& n 4&dw nxw w nw w nw w nx nh ?&h pH& $Q& n Z&x nPy Ty nd{ h{ n| nL/c&| n  n< k&< |& nP T n  n  &L & & &  &D n< @ &@ &D\ nă Ѓ nL T n ą nD &( &(4 nX \ '\ nl p n  n  nH X n  n  nL 5' n$ ( n  n  ?'  H' , c'L\ n  w' n  '( n  ' ' n Đ n  0 nX \ n` d n ē n  n$ 8 n  n nD nP/'P/'h/'Ț 'Țx n$ @ '@< n@ | n  n  n n  ' ( n  (h (p !(T n, 8 6(8 n 8 J(8 `(ĭH n$ @ n,  n   nh l nD H nl  n  n  n n\ e( m( n,  0  n$  ,  n   n   n4 8 n  n$ 8 n  n n t( (( (8 nH (t (t nu u (u nHy nx n (y nhz lz nL| n (T| n`} n (d} n} } n~ ~ n(~ n  0n ( 8n0 nl/(l/(p/)80)0~ nd~ )h~ n~  n  nd l n n &) 0)0 9)$ n  H)  T) | i) nT | n  n` ̉ n8  n$  np  n  n ̛ np  nȜ ̜ n  nD H n  n  n n y) %) %) ) n 5 ) )\ n  ) n  ) ) n $ nؤ @ )@ nT X *X, nX  * n  &* n ث 7*ث  n  n  n@ n A* O* Pn4 Z*X n nT b*̺ nP T nĻ h n  n  n(  nL n 5 l*X w*Xl * nt x n0 H n\ p n  n , n  n  n  n  n * * n$ ( n * n  @ n  n n * n * * n  n  n  n  * *X n, 0 nH T n  n  n  * n $ np  n  n0 @ n\ ` * nl p n  n  +0 n  n n + nL, %+ /+ nL  n ;+ C+ 0F+  0nP a+ h+ |+lP n  + + n  n  + n , +,P nt | +| n  nt  +P n  +x nH T +T8 + n    , L ',`   n   n   n4  l  :,l  n  n ( O,( W,` n8 n| b, nH k,L n ( n @ n" nT# s," |,D$ n$ $ n@& L& n' ' n) () nh* ,p* ,* ,* n* L, ,\, n8- L- ,L-L ,- n(. 0. ,0. ,8. ,. nd0 p0 -p0 n01 D1 -D1 nT1 X1 5-X1H n2 2 ?-2P n2 2 S-2 n|3 3 f-3 u-`4 n4 5 n7 @8 -@8$ n\8 d8 -d8P -84 -8P -89 n9 9 -9 nl: p: .p: n; ; *. ;D n; ; nC dC =.dC nD E J.E  nK n$ R.% Dj.H% nd% s.$L z.$Ld nL L .L nL L .L nLM XM .XM .`M .M( n N N .NP .dN .hN n,O 4O /4O nO O /O nP P 6/P( nQ Q R/Q nS _/Wx S r/S nhU xU n|W W nW X n] nD) z/) D/) n /] /] n^ ^ / ^ n^ ^ /^H n^ ^ /^L /<_ n_ _ 0_ 0_ "0l` n` ` >0`| nla ta R0ta n c c \0c( n1{4 n,| 0| T10|( nT| X| d1X|@ q1| n } (} {1(}|  np} } n  1 n, D n n- n- 1 1 1 n nl1 n 5 1 nh  n n 1 18 n  1 n  2 )2L n@ H C2H nĜ ̜ n  n  n  n0 d n  n H n  n  np  n \ n n|4 n(* ]2( n nT8 f2 m24 n  $ n  n$ 0 nh8 n<0{2<02@028 28@ nt x 2xT nȿ ̿ 2̿T n  2  n  2 nd n8 n8 2 2 nx  n  n  n n9 39 A39 An4: 3 3 nl p *3p0 n  73 np | C3|t P3\ n< L n  nt  n  nt x n  nD: m3D: 0n x3  ~3  n  3P n  3 \ n\ h 3h nt  3, 3 3 n8 3 3 D 4D n  4x n  &4T n  948 H4  nh  [4x n  o4  n, 4 44 n   4( n4 8 48X np  4l n  44 n 0 40 n  4|| n  5 n  5\ (5 nT X C5Xh R5P a5X n  p5H nP ` 5` n< P 5PT n  n  n   nd  t  5t \ n   5  n|   5 @ n  n  5 5L nT  n# $ 5$0 n4% H% n* + 6+4 nX+ , n2 P2 n03 n@<  6@< 6L<  6< D76< n 5 E683 nh3 l3 n3 P63 `638 p63$ n4 5 n5 5 n@5 D5 n 6 6 n7 7 n0: P: n: < n`= x= nD nI 6D 6D  nP Q 6QD nQ Q 6Q 6S nT T n,U 4U nU n J 6U nV V nxW 6LJ 6MJ 6|W 6|W nX X n(` T` nPJ 66t` n` 6` na 6a nDb 6\b nb 6b nc 6(c ntc 6c nc 6c nLd 6`d nd 6d n$e 68e ne 6e ne 6f nhf 6|f nf 6f n@g 6Tg ng 6g nh 6,h nh 6h nh 6i n\i 6pi ni 6i n4j 6Hj nj 6j n k 6 k nxk 6k nl 6l nxn 6n nn 6n nn 6o n4o 6@o no 6o no 6o n0 ,>" @>%( X>M( n 6 n 6 q> n 6  >  n 6 7| n 6t >u n 6$ 6% n 68 >9 n 6 > n 6t n, n > @> @> <>< 2?p @np s;p ,8t ?t  ?x ,?x 9?x 38| K?| n n;Y8;c8;l8\<z;`<;h<;p<X?t<q8x<a? l? nn ?P ?X n0n,?L nL? nPnl?L nxn? n? n? n n? n? n( n8? n( np? nl@ n @  nx  5 n( @( n4 &@4 2@0 C@8 L@, _@8 nLJ n 8# nH# L# 6 $ $ 6x( |( 6* * u@XK( @@e( @D  @_ @d @, @J  @X4@ Ap 'AQ 9A IA YAs cA AX#A0Bl Ap_, A | A A8 A< AX At BTL B,BQ` 5B  CBą ^B9P oBP BL Bd BB BT BT BC< p Ch~ !C 6C EC DWCT kC uC4 C Cfl C C'0 CC,p C0h Dh` DD h+D8 D=D@ LD, ZDW< dD  oD`D3 Dl DH< D8 D D< DWT E@ E) E .Ezp 9E0$ DE5 bE oE EhP E ED E EZfX HZx` UZG cZT pZ xZ Z* Z0$ ZT8 Z Z Z Z,  Z|{ ZB( [`@  [H4 %[8[Dp M[+ [[CH i[C (y[< [x4 [< [ęt [.A[[x[V [<\f \T%\Ed .\ w4 ?\ L\4 ]\,  m\0 }\dl \ \F\9 \@7( \HG \` \< \( \ ]S ,]4J %]F.]|a G] Q]bl c]D  s]] ]\JX ]L ]n` ]@@]4t ] ]( ^7 ^1^N >^v8 T^?| d^Xt t^P | ^ ^4 ^^^T ^J  ^t _D# _\ _!kl 0_G  A_<7 R_ __p__LT  _ _ut _ _ __` `X` #`  2`4 C`@ S`$h h` w`H `[@ `` `8L `^@` `p `T ` a{< a4H )adr\ 1a3 Ba4 QaX ` ea^\ qaa^ a$ aS ax adM( at a; a bbl -b 8b$ GbM  Tb ebxb/ b bx bD bbWl b  b( bcCp cT4 0ct: `Dc2P Vcjcc( c, cl cFcQT cܑ c` c cd d d*l "d0T 3d$@ DdZd$d fd̷xdQl d, d( d`t dd dL3D d< el\ eH( &eu( 5eF Ce\ Ze؆P eh e( e&ee` eL eef  f |` )fpx Cf, Of Xfift fd}\ f ft f8 f ff g)g@ 1g x HgD ]gL ngg| gHM gd gV g, gx gD g8< gx Dh , hlI /h< >h Mhu ]hrh hjl h8 h$ h<#l h5( hp hi(h i|O0 -iEi4` ViL<  ci&ti i̺ i0$ i|9x i i i i i" i(( iP1A+ j%jh\P 1j =j8W  Tj0 hj$ }jcl j jH jċ j<7 j  jpw0 j\J j88| k kt /k4U ?kR Pk dk$d |kLth k kk@ k. kH k" kx5 l,N lP2 l  /l@d GlZl\ nlp zllv4 lȠL l$5t l lh l l4  lL l h mh m D)m|p| :mTL Vm, bmR qmP m( m: m4< mms| m mM m nR n't n )n7nIn| Wne gnT0 zn  nh nOL n n3P n8 nL nnĶL n o4 od( o] 3o&EoȏT Vo goo4 xoo oB, oT oP5 o o|P oo p p.p@p  Gpt TpͶ ap0 rp p$\ ppfp  p͐ p p p@ p4 p q0!L !qr` 4q` Yq0D eqT uqT q( q \q L q8h q-hl q$ q1 q}fl r (r8H 7rt DrTH Nr, Zradl eru zr$@ r$ r r0E$ rBH r rX rD5 s`  8sL Ds@ ZsysЀd ssT8 s s s0 s@sx` Ixdx Px Zxlx(G xx!x  xX xR x$ xw xxx/ yy y@ !yXC8 +y, 8yJy) ]yY  oyE y: xyLH y& y y 0 ҅: ޅJ  fԊ * < IdYdw l h ~< 4<  x 0 Ɇ]b` цX R 0~8 Bl F!G .\L >  N̜< h {xU \C\ h@. p " ćXI чld އ\6 ^  R $ 6 Pb m| P 4 @ @ ˈp ؈H  L qil .L BP N `l0 r (\ O, U` t | ÉՉT މx \| !1 1O, ?P Wx d; v8 <( , @(( 4` ъF  . pp $< $ >  ( 0\X Cx P H `( k0 t$  ؘ, x C 8 ֋TM LL TfT HL  ( 5Ugl E XpP g4 {h 0  F njh Ռ$x \ 02  H A - D)l1 D=D J  Vb bh hoH4  Ф   č̜D эw  d gl T + <=X H  \d l4 xL 48 f " ώ ݎFT l`L  !N 0H BPC jz LR Ђ w Տq 8 h{l ؂  q 4}L A, MC Y<7FPjm w 4 _p ƐId ҐO ؐ̂ OYpD  '9L& DDThT^4 sQ P, @ (d D đ ґ8a| t ̂ F  < l, ,$"h 5 E4p YX on(   @ D$H Ȓ0 Ւh < | el $` 3 JI YMx d o`)e T P h  ȓ@T  ؓa 0   [4 3  . 6 N( [@ lC( |FL x X< | ՔDWT ( [\ x\ R -0, I S ^F f!  tЈFH p t =8 W<@ f p`S( ,P, ` PH T( aH Θ p RT  ,H >H K^|9 v,  PK  ęd ՙt  d O ( 8dH H@@ TL g  s8  ` 0` u`T T4 ƚ  њS ܟ |p  M #h * 7 I4 `wH v4 P  vL ӛs ̛ H  T (!4A .\8 @XE8 l |-@  S Ü4l ֜ S8 tJ ̈F$^, 3EU4 dtd s| R ol ` m ӝt(   \ , P ,CH 9L/@ J(( X8 jľt {| h, 7 H\ Ǟl7 Ԟ̤ ݞh$ ݵ ȷ + 48 G a!4 l d   Ѓ  X l9 ן{(    w$ 4h_H Kl ]L lxz |xT$ hT 0 L @T|  8q Р ܠ$ d `8 hl @ 3M/  _ o9t |h(   S 2` áē\ ϡD `  @w4 ` +t5 @FE< W\l}Aop HN < ΢, ڢC k (@ OHC h7 + <|| L[ 8x X ] ͣB4 ܣ4( ( 4 L5 $ %(( @1<P :\( Mv4 `) m {`< h| Ԥ| t \ Ťy` ӤoH e4 TP #`Q 0L F: ]P s\ fH   T|(   L ̥ݥmd  $ H,A  "l 1 >P^ LTkp W l|h (- ( Ȧ[ Ц,# ֦pp < 0T $q 9 JZs$ lq8 xl@ P@ G  ͧ5 ݧx  <: 8) J 9 LX E@k Pؘ Z|4 xd0 x D P, ` hP è4^ΨT s8 () xn bh -tr 7WT DY il\ |S p*T X D| Ʃx ݩlNX <h dy $ 0z /home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-libc-final/csu/abi-note.o$d/home/dom/projects/crosstool-ng/install/bin/.build/arm-linux-gnueabihf/build/build-libc-final/csu/start.o$ainit.c/root/rpi/tools/arm-bcm2708/arm-rpi-4.9.3-linux-gnueabihf/bin/../arm-linux-gnueabihf/sysroot/usr/lib/crti.ocall_weak_fn/root/rpi/tools/arm-bcm2708/arm-rpi-4.9.3-linux-gnueabihf/bin/../arm-linux-gnueabihf/sysroot/usr/lib/crtn.outil.cSplitPath_xBinToCharStr_xBinToHexStr.constprop.4TagCmpzalloc.part.0_DbgMsgBinWriteMemoryCallback_Hexs0_f__FUNCTION__.10038__FUNCTION__.9273__FUNCTION__.10023__FUNCTION__.9716__FUNCTION__.9856__FUNCTION__.9884__FUNCTION__.12521__FUNCTION__.9748__FUNCTION__.9782__FUNCTION__.9817__FUNCTION__.10062__FUNCTION__.10132__FUNCTION__.10565__FUNCTION__.10737__FUNCTION__.10745__FUNCTION__.10769__FUNCTION__.10782__FUNCTION__.10789__FUNCTION__.10794__FUNCTION__.10803__FUNCTION__.10815__FUNCTION__.10822__FUNCTION__.10849__FUNCTION__.10857__FUNCTION__.10865__FUNCTION__.10915__FUNCTION__.11041logicMappingresultMapping__FUNCTION__.12532__FUNCTION__.13626__FUNCTION__.13674mutexExitfileMsgToDiskmutexDebugMsgmutexMsgQueRegMutexNumMutexGrouphttp.cpickoneauthhttp_should_failhttp_getsock_doreadmoredatahttp_perhapsrewindhttp_output_basiccheckhttpprefix.isra.2checkprotoprefix.isra.3header_appendexpect100CSWTCH.118url.csetstroptllist_dtorget_protocol_familyparse_login_detailssetstropt_userpwdconn_freedo_completesetup_rangefix_hostname.isra.3IsPipeliningPossible.isra.4parse_proxy_auth.isra.6check_noproxyfind_oldest_idle_connection.isra.10signalPipeClose.constprop.13disconnect_if_deadcall_disconnect_if_deadCSWTCH.183protocolsCurl_handler_dummymain.cdbgWriteFile.part.8dbgWriteFileX.part.9__FUNCTION__.11415__FUNCTION__.9213__FUNCTION__.9220__FUNCTION__.9297__FUNCTION__.11420__FUNCTION__.11426__FUNCTION__.9199__FUNCTION__.9513__FUNCTION__.9206__FUNCTION__.11408__FUNCTION__.9368__FUNCTION__.9385__FUNCTION__.9679__FUNCTION__.9703__FUNCTION__.9757__FUNCTION__.11386__FUNCTION__.9239__FUNCTION__.9250__FUNCTION__.9306__FUNCTION__.9311__FUNCTION__.9351__FUNCTION__.9558__FUNCTION__.9565__FUNCTION__.9572__FUNCTION__.9579__FUNCTION__.9589__FUNCTION__.9599__FUNCTION__.9622__FUNCTION__.9636__FUNCTION__.11319__FUNCTION__.11397__FUNCTION__.12118__FUNCTION__.12148cnt.11409sec.11410cmd.9725_arg_num.9724cmd_data.9726cmd.9732_arg_num.9731cmd_data.9733cmd.9739_arg_num.9738cmd_data.9740cmd.9746_arg_num.9745cmd_data.9747reboot_cnt.12096crtstuff.c__JCR_LIST__deregister_tm_clonesregister_tm_clones__do_global_dtors_auxcompleted.8965__do_global_dtors_aux_fini_array_entryframe_dummy__frame_dummy_init_array_entryconnection.cSchdStartRecvCmdIotmCoreTask__FUNCTION__.10556__FUNCTION__.10685__FUNCTION__.10064__FUNCTION__.10143__FUNCTION__.10169__FUNCTION__.10179__FUNCTION__.10187__FUNCTION__.10307__FUNCTION__.10341__FUNCTION__.10583__FUNCTION__.10620__FUNCTION__.10676__FUNCTION__.9987__FUNCTION__.10011__FUNCTION__.10092__FUNCTION__.10316__FUNCTION__.10323__FUNCTION__.10366__FUNCTION__.10541__FUNCTION__.10700__FUNCTION__.10727__FUNCTION__.10755__FUNCTION__.10846__FUNCTION__.10870__FUNCTION__.10886__FUNCTION__.10924__FUNCTION__.10957__FUNCTION__.10972__FUNCTION__.10984__FUNCTION__.11001__FUNCTION__.10993__FUNCTION__.11032__FUNCTION__.11044__FUNCTION__.11056__FUNCTION__.11077__FUNCTION__.11150__FUNCTION__.11218__FUNCTION__.11235__FUNCTION__.11281qIotmCoreTaskmutexSysPwmutexParseIptablewdtEnablesend_cnt.10979exit_cnt.10980mutexDrvTcpCmdcurtain.cCurtainTaskSend__FUNCTION__.9606__FUNCTION__.9596JsonVarSetDev_gqCurtaintoken_t.9600dev_f.c__FUNCTION__.11270__FUNCTION__.10387__FUNCTION__.10406__FUNCTION__.10029__FUNCTION__.10947__FUNCTION__.10956__FUNCTION__.10961__FUNCTION__.10968__FUNCTION__.10976__FUNCTION__.11009__FUNCTION__.11017__FUNCTION__.11028__FUNCTION__.11046__FUNCTION__.11058__FUNCTION__.11063__FUNCTION__.11069__FUNCTION__.10796__FUNCTION__.10361__FUNCTION__.11238__FUNCTION__.11333__FUNCTION__.11417__FUNCTION__.11431__FUNCTION__.11441__FUNCTION__.11474__FUNCTION__.11497__FUNCTION__.11503__FUNCTION__.11509__FUNCTION__.11515__FUNCTION__.11521__FUNCTION__.11563__FUNCTION__.10461__FUNCTION__.11530__FUNCTION__.10043__FUNCTION__.10014__FUNCTION__.10186__FUNCTION__.10209__FUNCTION__.10071__FUNCTION__.10281__FUNCTION__.10324__FUNCTION__.10421__FUNCTION__.10805__FUNCTION__.11643feibit.cConvertOopStringCreateDev_sZllTask__FUNCTION__.9786__FUNCTION__.9804__FUNCTION__.9825__FUNCTION__.9840__FUNCTION__.9845__FUNCTION__.9874__FUNCTION__.9889__FUNCTION__.9903__FUNCTION__.9913__FUNCTION__.9921__FUNCTION__.9929__FUNCTION__.9936__FUNCTION__.9942__FUNCTION__.10055__FUNCTION__.10059__FUNCTION__.10065__FUNCTION__.10070__FUNCTION__.10155__FUNCTION__.10091gateway.10080disconnect_sec.10086FeibitSimpleAliveReceiveStateRespGwInfozllRestartgateway_sn.10081gateway_sn_src.10082gw_type.10083search_cnt.10084alive_cnt.10087disconnect_cnt.10085giga_iot.cCreateIotDeviceGigaDrvTask.part.1__FUNCTION__.10087__FUNCTION__.10105__FUNCTION__.10068__FUNCTION__.9974__FUNCTION__.10005__FUNCTION__.10015__FUNCTION__.10035__FUNCTION__.10050__FUNCTION__.10181__FUNCTION__.10198__FUNCTION__.11411__FUNCTION__.10213__FUNCTION__.11259__FUNCTION__.11264__FUNCTION__.11269__FUNCTION__.11298__FUNCTION__.11302__FUNCTION__.11332__FUNCTION__.11452mutexControlBoardcnt.10047scan_can_cnt.11406scan_new_dev_cnt.11407qIotCanR1PrepareSendScanCanDevScanCanDeviceValidTimerCanR1ExistqIotCanIotmqGigaIotgigatech.cGigatechTaskSend__FUNCTION__.9667__FUNCTION__.9681JdqGigatechhuayue_dbox.cHuayueTaskSend__FUNCTION__.9629__FUNCTION__.9605__FUNCTION__.9595qHuayuetoken_t.9599iotm_f.cIotAliveTaskProcessSceneInpFile.part.1IotCoreTask_drvUpdIotPara.part.7cbRegProfile__FUNCTION__.9948__FUNCTION__.9964__FUNCTION__.10134__FUNCTION__.10154__FUNCTION__.10542__FUNCTION__.10590__FUNCTION__.10785__FUNCTION__.10798__FUNCTION__.10811__FUNCTION__.10193__FUNCTION__.10208__FUNCTION__.10252__FUNCTION__.10622__FUNCTION__.10885__FUNCTION__.10392__FUNCTION__.10458__FUNCTION__.11039__FUNCTION__.11052__FUNCTION__.10566__FUNCTION__.10839__FUNCTION__.10752__FUNCTION__.10710__FUNCTION__.10872__FUNCTION__.11060__FUNCTION__.11066__FUNCTION__.10060__FUNCTION__.10004__FUNCTION__.11072__FUNCTION__.10069__FUNCTION__.9958__FUNCTION__.10967lumex.cCbBusyLumexTaskTickSecCreateDevLumexTaskSend__FUNCTION__.11223__FUNCTION__.11329__FUNCTION__.11273__FUNCTION__.9744__FUNCTION__.9863__FUNCTION__.9774__FUNCTION__.11324__FUNCTION__.9839__FUNCTION__.11236__FUNCTION__.11284__FUNCTION__.9739GatewayPortqLumexGatewayIpGatewayTokenGateWayFoundLumexIRpatch.ccbBrowseIotFilecbBrowseDeviceFile__FUNCTION__.9802__FUNCTION__.9781paraMergeDevIotpidfile.cpml1000.cPml1000TaskSend__FUNCTION__.9631__FUNCTION__.9610qPml1000token_t.9624r1.c__FUNCTION__.10791__FUNCTION__.10797__FUNCTION__.10858__FUNCTION__.11064__FUNCTION__.11254__FUNCTION__.11271__FUNCTION__.11289__FUNCTION__.11303__FUNCTION__.11308__FUNCTION__.11313__FUNCTION__.11318__FUNCTION__.11341__FUNCTION__.11358__FUNCTION__.11423__FUNCTION__.11432__FUNCTION__.11450__FUNCTION__.11372__FUNCTION__.11393__FUNCTION__.11409__FUNCTION__.11244__FUNCTION__.11485__FUNCTION__.11496__FUNCTION__.11546__FUNCTION__.11562__FUNCTION__.11569__FUNCTION__.11576__FUNCTION__.11606__FUNCTION__.11620__FUNCTION__.11713__FUNCTION__.11520__FUNCTION__.12086ConnectToIotmLedActionLedCounteralive_cnt.11506saswell.cCustomTaskSaswellTask_FindAirCondDef.part.0VerboseAppend.part.1SaswellTaskLoop__FUNCTION__.10082__FUNCTION__.10267__FUNCTION__.10173__FUNCTION__.9733__FUNCTION__.9843__FUNCTION__.10008__FUNCTION__.10224TmpDevqCustomtoken_t.10260TaskReadyqSaswelltoken_t.10166sched.cSchedualTaskSchedualTaskTickWeekText__FUNCTION__.9393__FUNCTION__.9401__FUNCTION__.9352__FUNCTION__.9432__FUNCTION__.9477qSchedualTaskSysTickCbTablesecurity.c_ArmLedOn.part.2_ArmLedOff.part.3__FUNCTION__.9813__FUNCTION__.9822__FUNCTION__.9834__FUNCTION__.9945__FUNCTION__.9981__FUNCTION__.9985__FUNCTION__.9989__FUNCTION__.9993__FUNCTION__.9997__FUNCTION__.10129pwron_delay.10147zone_active.10148volksen.cVolksenTaskSend__FUNCTION__.9650_volk_protocol_onoff_volk_protocol_ccsockGwqVolksentoken_t.9639crc16.cjsmn.clib_frag.cLibFragTask__FUNCTION__.9417__FUNCTION__.9438__FUNCTION__.9450__FUNCTION__.9457__FUNCTION__.9491__FUNCTION__.9508__FUNCTION__.9542__FUNCTION__.9616__FUNCTION__.9645cbFragFinishIotkPortEventIdCntqLibFragTaskmutexSendToIotklib_list.c_AbstractListMalloc_AbstractListFree__FUNCTION__.9396sunxi_i2c.ccompress.cuncompr.cdeflate.clongest_matchfill_windowdeflate_fastdeflate_storeddeflate_slowconfiguration_tableinflate.clenfix.6146distfix.6147order.6175inftrees.clext.6059lbase.6058dext.6061dbase.6060trees.csend_treecompress_blockbuild_treeextra_lbitsbase_lengthextra_dbitsbase_diststatic_ltreestatic_dtreebl_orderextra_blbitsstatic_l_descstatic_d_descstatic_bl_desczutil.cadler32.ccrc32.ccrc32_combine_crc_tableinffast.cini.ceasy.ceasy_connectioninitializedinit_flagsconnect.cconn_is_connverifyconnectgetaddressinfosingleipconnecttrynextipmulti.cmstatesh_freeentryfd_key_comparehash_fdmulti_freeamsgmulti_freetimeoutmulti_addtimeoutmulti_timeout.isra.2.part.3update_timeradd_next_timeout.isra.6multi_getsock.part.4.constprop.8singlesocketmulti_runsinglemulti_socketfinit.10853tv_zero.11261strerror.cCSWTCH.3CSWTCH.5CSWTCH.7select.csplay.cKEY_NOTUSED.6838slist.cnonblock.cwarnless.cconncache.cconn_llist_dtorbundle_destroyfree_bundle_hash_entryconncache_remove_bundlepipeline.csite_blacklist_llist_dtorserver_blacklist_llist_dtortimeval.chostip.chostcache_timestamp_removecreate_hostcache_idalarmfuncfreednsentry.part.0freednsentryfetch_addr.isra.1hostname_cachehost_cache_initializedprogress.ctime2strmax5datacookie.cfreecookietailmatchcookie_sortsanitize_cookie_pathget_netscape_formatremove_expired.isra.0isipsendf.cshowits_infotype.10714CSWTCH.25CSWTCH.26dict.cunescape_worddict_doif2ip.cspeedcheck.cversion.cversion_infoinitialized.10425version.10426initialized.10435getenv.cescape.cmprintf.caddbyteralloc_addbyterstorebufferdprintf_DollarStringdprintf_formatflower_digitsupper_digitsnull.8338strnil.8352telnet.ctelnet_donecheck_telnet_optionssend_telnet_dataprintsub.part.1sendsuboptionprintoptionsend_negotiation.isra.3suboption.isra.4telnet_dotelnetoptionstelnetcmdsnetrc.cgetinfo.ctransfer.cstrlen_urlstrcpy_urlstrequal.cwildcard.chttp_chunks.cCSWTCH.8llist.cCurl_llist_remove.part.0hash.chash_element_dtorshare.chttp_digest.chostip6.cipv6_works.10623hostsyn.cparsedate.cweekdaytzmonth_days_cumulative.8177tftp.ctftp_translate_codetftp_disconnecttftp_getsocktftp_rxtftp_set_timeoutstftp_connect_for_rxtftp_txtftp_connect_for_txtftp_connecttftp_donetftp_setup_connectiontftp_option_add.isra.1tftp_state_machinetftp_multi_statemachtftp_dotftp_doingstrdup.csocks.crawstr.ccurl_addrinfo.ccurl_memrchr.cimap.cimap_is_bcharimap_sendfimap_block_statemachimap_disconnectimap_getsockimap_get_messageimap_atomimap_perform_listimap_continue_authenticateimap_doneimap_perform_searchimap_perform_fetchimap_matchrespimap_endofrespimap_perform_authenticateimap_multi_statemachimap_dophase_done.isra.6.part.7imap_doingimap_perform_login.part.9imap_perform_authenticationimap_setup_connectionimap_statemach_actimap_connectimap_doCurl_handler_imap_proxysaslimappop3.cpop3_donepop3_continue_authpop3_disconnectpop3_getsockpop3_get_messagepop3_perform_authpop3_multi_statemachpop3_doingpop3_endofresppop3_setup_connectionpop3_perform_apop.part.12pop3_perform_authenticationpop3_connectpop3_statemach_actpop3_doCurl_handler_pop3_proxysaslpop3smtp.csmtp_continue_authsmtp_perform_commandsmtp_perform_rcpt_tosmtp_block_statemachsmtp_disconnectsmtp_getsocksmtp_get_messagesmtp_perform_authenticationsmtp_parse_url_pathsmtp_donesmtp_perform_authsmtp_multi_statemachsmtp_dophase_done.isra.5.part.6smtp_doingsmtp_endofrespsmtp_setup_connectionsmtp_statemach_actsmtp_connectsmtp_doCurl_handler_smtp_proxysaslsmtppingpong.crtsp.crtsp_getsock_dortsp_setup_connectionrtsp_disconnectrtsp_connectrtsp_donertsp_dortsp_rtp_readwritecurl_gethostname.cgopher.cgopher_dohttp_proxy.ccurl_sasl.csasl_digest_md5_to_asciisasl_create_oauth_bearer_messagesasl_digest_get_key_valuesasl_create_plain_messagesasl_create_login_messagedotdot.cvtls.csafe_strequalseeded.10790randseed.10789file.cfile_setup_connectionfile_disconnectfile_donefile_connectfile_dobase64.cbase64_encode.isra.0base64base64urlformdata.creadfromfileformboundaryAddFormDataAddFormDatafformdata_add_filename.isra.1ctts.10528ftp.cfreedirsftp_state_userftp_state_loggedinftp_disconnectftp_multi_statemachftp_getsockftp_connectftp_statemach_actftp_endofrespftp_state_retrftp_state_use_pasvftp_state_ul_setupisBadFtpStringftp_state_use_portftp_timeleft_acceptAcceptServerConnectInitiateTransferwc_data_dtorftp_parse_url_pathftp_setup_connectionftp_state_user_resp.isra.1ftp_domore_getsockftp_epsv_disableftp_state_pasv_respftp_nb_typeftp_state_type_resp.part.6ftp_state_typeftp_state_sizeftp_state_mdtmftp_state_quoteftp_state_prepare_transferftp_state_restReceivedServerConnectAllowServerConnectftp_do_moreftp_dophase_doneftp_doingftp_doftp_donemode.11212mode.11156Curl_handler_ftp_proxyftpauth.11477fileinfo.cftplistparser.cPL_ERROR.isra.0ftp_pl_insert_finfo.isra.1md5.cbodyMD5_InitMD5_FinalMD5_Updatehmac.chmac_ipadhmac_opadcurl_fnmatch.cloopwiringX.c$tsetupplatformbananapi.cbananapiGCbananapiI2CReadbananapiI2CReadReg8bananapiI2CReadReg16bananapiI2CWritebananapiI2CWriteReg8bananapiI2CWriteReg16bananapiWaitForInterruptpiBoardRevbananapiDigitalReadbananapiDigitalWritebananapiPinModebananapiI2CSetupbananapiISRpinToGpioR3pinToBCMR3BP_PIN_MASKedgesysFdspinToGpioR2wiringBPModephysToGpioR3pinToGpiopinModesgpiophysToGpioorangepi.corangepiPinModeorangepiGCorangepiI2CReadorangepiI2CReadReg8orangepiI2CReadReg16orangepiI2CWriteorangepiI2CWriteReg8orangepiI2CWriteReg16orangepiWaitForInterruptorangepiDigitalReadorangepiDigitalWriteorangepiI2CBlockWriteReg16orangepiI2CBlockWriteReg8orangepiI2CBlockWriteorangepiI2CBlockReadReg16orangepiI2CBlockReadReg8orangepiI2CBlockReadorangepiI2CSetuporangepiISRhummingboard.chummingboardPinModehummingboardI2CReadhummingboardI2CReadReg8hummingboardI2CReadReg16hummingboardI2CWritehummingboardI2CWriteReg8hummingboardI2CWriteReg16hummingboardGCidentifyhummingboardDigitalWritehummingboardDigitalReadhummingboardI2CSetuphummingboardWaitForInterrupthummingboardISRpinToMuxAddrpinToGPIOAddrpinToBinpinsToGPIOspiBPWspiFdsspiSpeedsspiModeradxa.cradxaDigitalReadradxaDigitalWriteradxaSPIGetFdradxaKernelVerradxaGCradxaI2CReadradxaI2CReadReg8radxaI2CReadReg16radxaI2CWriteradxaI2CWriteReg8radxaI2CWriteReg16radxaSPISetupradxaSPIDataRWradxaWaitForInterruptradxaBoardRevradxaI2CSetupradxaPinModeradxaISRradxaSetuppinToGPIOvalidGPIOrk3188_pin_ctrlrk3188_pin_banksainci20.cci20DigitalReadci20DigitalWriteci20PinModeci20I2CReadci20I2CReadReg8ci20I2CReadReg16ci20I2CWriteci20I2CWriteReg8ci20I2CWriteReg16ci20GCci20WaitForInterruptci20I2CSetupci20ISRraspberrypi.craspberrypiDigitalWriteraspberrypiPinModeraspberrypiI2CReadraspberrypiI2CReadReg8raspberrypiI2CReadReg16raspberrypiI2CWriteraspberrypiI2CWriteReg8raspberrypiI2CWriteReg16raspberrypiGCraspberrypiWaitForInterruptraspberrypiI2CSetupraspberrypiDigitalReadraspberrypiISRgpioToGPCLRgpioToGPSETgpioToGPFSELgpioToShiftgpioToGPLEVboardRev.7795pinToGpioR1physToGpioR1BCM2708_PERI_BASEphysToGpioR2piModel2_udivsi3.o.udivsi3_skip_div0_test_divsi3.o.divsi3_skip_div0_test_arm_addsubdf3.o_aeabi_ldivmod.o_aeabi_uldivmod.o_dvmd_lnx.olibgcc2.cbpabi.c_lshrdi3.o_ashldi3.oelf-init.c__FRAME_END____JCR_END____init_array_end_DYNAMIC__init_array_start_GLOBAL_OFFSET_TABLE_Curl_connectpthread_mutex_unlock@@GLIBC_2.4CreateIptableget_crc_tablefunc_CT_R1_DO3ReadIotmTcpEncrypt_iotAttachSceneSendDataToIotkiotPackCtrlSelListRemoveWorkingDirFiledbgDispDevDefault__libc_csu_finiSecurityDrvTaskiotDevPrsCurl_pipeline_set_server_blacklistcalloc@@GLIBC_2.4dbgDbgDispPwMasterfunc_CT_R1_DO1Curl_readUpdCtrlBDataInitZoneStatusAddLumexDeviceiotLoadProfile_DispSecuDoChkPatternValidstrstr@@GLIBC_2.4i2c_init_iotmInitFileCurl_conncache_remove_connUpdDevDI_PDN1170_xiotMakeFileTmp__aeabi_uldivmodCurl_pipeline_set_site_blacklistgetpwuid_r@@GLIBC_2.4FreeMJsonObjDbgSplitString_xIOT_DIRTYraise@@GLIBC_2.4AddMJsonStringcurl_easy_escapeCurl_set_dns_serversini_get_stringCurl_handler_httpReadTextByIptableIdcurl_freePostDeploySleepSplitStringwiringXI2CBlockReadReg16_iotPackCtrlFullListCurl_ip2addrcfmakeraw@@GLIBC_2.4iotPackSysProftCurl_ipv6worksDispDbgAllgmtime_r@@GLIBC_2.4MapSecurityCurl_handler_tftpiotmUpdateFileiotRemoveFiledbgLvlSetCurl_failfProfileFeibitGwExistCrc16TableCurl_sasl_create_digest_http_messagecurl_mvsprintfCurl_llist_allocIptableNotifyTaskProcessSceneInpFileSearchMacSnIotkBlkSizeUpdDevDI_DL_z__aeabi_uidivCurl_if2ip_iotAddLogCurl_ftp_parselist_data_alloccurlx_uztoulUpdateJsonVarSetExtractUartDevPackJobjRegIotDevInitConnectionVarCurl_retry_requestWrFeibit_ColorDmComboItemNuminfoTaskutf8_length__gnu_uldivmod_helperresultStrbananapiValidGPIOTestFeibitdbgSchedualTimestrcmp@@GLIBC_2.4GetIp_RS232LoadSecurityFilecompress_FindAirCondDefCurl_urldecodeTestCompressSetIotkBlkSizeCombo_VData_IsSceneEventPasssqlUpdRs232ContentbananapiInitstrtol@@GLIBC_2.4Curl_pp_getsockCurl_pp_initsqlSelectDevicecurl_multi_fdsetDispCanErrRecdmutexSecuDispModelDefaultByDevid_devPackContent_ITM_deregisterTMCloneTableIsFileExistsetsockopt@@GLIBC_2.4strcspn@@GLIBC_2.4curl_global_cleanupdata_startgloDbgLvlStopControlBoardInfo_xPostSchedTimeci20InitDriverSendCmdAllcbTestDirCurl_reconnect_request__aeabi_ldivmodcurl_easy_getinfodbgChkIndoorOnLinetimes@@GLIBC_2.4MiniCmsIpCurl_hash_clean_with_criteriumCreateMJsonObjIotDevClearCurl_splayCurl_multi_pipelining_server_bldbgSaveToDiskUpdDevDI_PDN1120_zprintf@@GLIBC_2.4cbFragTickGetStringFragmentdbgRGBtoHSV__bss_start__func_CT_R1_DI3fopen@@GLIBC_2.4WriteUtf8WorkingDirCheckTextCP_iotmPackAllFiles_RemoveSchedUnRegIotDeviceExecJsonIntCbfunc_CT_R1_DI1Curl_do_moregetifaddrs@@GLIBC_2.4Curl_protocol_connectingCurl_sasl_can_authenticateClrAliveTaskWdtinflateread@@GLIBC_2.4tcflush@@GLIBC_2.4tblOptionToDataBitGetIndoorMasterIPiotDelSceneIfIoRemoveR1VerMajorStartIptableNotifyTaskCurl_formpostheaderPatchProcessfflush@@GLIBC_2.4ControlBoardUnicastwiringXSetupdigitalReadinflateGetDictionaryCurl_splayinsertdbgWrI2cCan_ExecSchdCbDeviceDefaultTablegetuid@@GLIBC_2.4FeibitDrvTaskR1_ReadThenWriteByteCurl_strerrorDispSecurityIotmFilesCurl_handler_smtpFindGatewayCurl_expire_latestdrvUpdIotParadbgControlBoardPairmemmove@@GLIBC_2.4InitZoneValueini_get_longReadIotmTcpFragmentcurl_maprintfNonBlockingNetTask_drvUpdIotParaR1ModelTypeCurl_raw_equalChkIptIdArraySchdCbTestPrintSchedualCbFuncQSize_SendWcharStrnCopyCurl_setoptCurl_protocol_getsockListOpCreateRootdbgIotUnlinkParseSaswellTcpCmdCurl_open_WrCanBufStartLumexTaskParseLumexTcpCmdcurl_easy_performdrvDbgTurnOfffree@@GLIBC_2.4Curl_share_locktblOptionToDataTypeUpdDevDI_PDN1160lroundf@@GLIBC_2.4deflate_copyrightdbgDispAttrBerbosesqlUpdJsonOptionByNameDeleteQueueDispRegMutexGetCurTimeForCmscurl_version_infoProcessSceneGroupMapStringL2Rfgets@@GLIBC_2.4_tr_tallydbgSchedualPost_FindAirCondCmsActdbgHSLtoRGBSaveMsgStringOnlyToDiskUpdDevDI_zWrFeibit_OopCurl_multi_closed_iotPackCtrlSelectedCurl_add_bufferfdbgToDiskCurl_closeLoadAirCondTxtpthread_mutex_lock@@GLIBC_2.4Curl_pipeline_site_blacklistedStartSchedualTaskStartHuaYueDBoxTaskcurl_easy_unescapeFreeSepStringcrc32_combine64nanosleep@@GLIBC_2.4R1_ScanAllDeviceCurl_set_dns_local_ip6crc32IsPatternString_drvPostDataGetDinContactNumCurl_loadhostpairsbananapidbgDrvStartCurl_hash_cleanReqDinSet_DLCurl_output_digestsockTestinet_pton@@GLIBC_2.4Curl_getformdataDiff_us__aeabi_f2dHSLToRGB_255ReadAirCondFilestricmpCurl_free_request_statememcpy@@GLIBC_2.4ModifyIotmFilesAddFeibitDevicewiringXGCdrvBrowseModelIDStartVolksenTaskInitJsonVariotDevGetIpwiringXPlatformmutexAirConditemSetHex4dMallocTokenStringCurl_socket_checkRegCbFragFinishFeibitDevInfoDinCnfgCurl_set_dns_local_ip4ReplaceCharjoPacket_ActionwiringXI2CBlockWriteReg8BrowsePath_bss_end__CheckIptIdCurl_writeinflateResetKeepDrvTestTaskwiringXSerialOpenProcessScenecurl_slist_appendCurl_pp_vsendf_tr_init_edataCurl_fetch_addrpthread_mutex_init@@GLIBC_2.4WorkingDirxGetQueIdIpc_iotUpdAttrItemCtrlServerTaskCurl_slist_duplicateTcpConnecttime@@GLIBC_2.4digitalWriteCurl_raw_toupperCurl_recvpipe_headjoPacket_TestCurl_dedotdotifywiringXI2CReadReg8UpdDevDI_PDN1140D_zChkDbgLevelmutexSysInilseek@@GLIBC_2.4Curl_multi_max_total_connectionsListOpAppendCurl_unix2addriotExecSceneFileSetDbgQueryRespCurl_pipeline_penalized__strtok_r@@GLIBC_2.4CurlReadingcurl_formfreeDbgLvlBinUnPackFragmentDataListOpRemoveTreeinflate_copyrightdbgIotkLogCurl_chunked_strerrorPackTinyProfileGetCustomDevicedbgFeibitACheckIgnoreSpacenameuncompressWriteBinToFileftell@@GLIBC_2.4LedPinmemcmp@@GLIBC_2.4__adddf3inet_ntoa@@GLIBC_2.4pthread_attr_setstacksize@@GLIBC_2.4Curl_sendpipe_headselect@@GLIBC_2.4__divdi3GetSeperateStringCanWrite_DOCurl_pipeline_leave_readdbgDeploySleepsleep@@GLIBC_2.4CheckCanStatusCurl_cfreestpcpy@@GLIBC_2.4DispMutexStatusfreeifaddrs@@GLIBC_2.4ListOpRemoveLumexDevInfoPostDeployOutdoorCurl_digest_cleanupDbgLvlGroupProcessSceneUseritemSetIntinflateUndermineCurl_proxyCONNECTGetIotmCoreQRegTcpServer_finidbgIotmFilesAllcurlx_sztosidbgStartCanErrRecdmutexLumexDbgModelIdUpdDevDI_DLdevGetModelName_DispUartPortConvBinToHexStringCurl_base64url_encodewiringXI2CBlockReadCurl_FormInit__bss_end__recvfrom@@GLIBC_2.4MapIotCmdPDN1000_ActivexQueIpcTblSetDbgMsgDelaySchdCbTest2curl_multi_info_readListOpGetIndexstrdup@@GLIBC_2.4Curl_sasl_decode_digest_http_messagedevGetModelSysTagQRecvPktwiringXSupportedChkStringCurl_global_host_cache_initdeflatePrimeauchCRCLoCurl_cmallocCurl_http_readwrite_headersDrvWriteImeCurl_llist_countiotRegToIotmwiringXI2CSetupalarm@@GLIBC_2.4platform_registerCurl_sleep_timeLoadSysPwlogicConvertAddCanErrRecd__aeabi_dsubDbgPutsini_get_doubleUpdDevDI_OO_zCurl_hash_initCurl_hash_addmutexI2cMakeDefExtLinking_XdevGetFileByIptidCurl_infofString_PackStartdbgPingDestdbgWriteFileXitemGetStringsysconf@@GLIBC_2.4Curl_rtsp_connisdeadUpdDevDI_DI_zRespDataToIotLumexStrMappingCurl_memdupCrc16Calc__gnu_ldivmod_helperStartGigaTaskCombo_NDataIotNotifyCounterFeibitStartLearnNewDevdbgSysLogdevQueryRespBufwiringXLogrealloc@@GLIBC_2.4R1_ResetCanBusy_FindAirCondTypecurlx_uztosiCurl_mk_dnscache__aeabi_idivmodWriteTextSysDirwiringXI2CReadzErrorhummingboardCurl_socketdbgCurTimeSendCmdToIotk__floatdidfSetDbgToDiskSaveMsgStringToDiskhummingboardSPIDataRWAirCondProfileCurl_HMAC_MD5orangepicurl_multi_remove_handleini_flushwiringXAnalogRead_tr_flush_blockiotLoadFileFinishDispDbgActiveStartLibFragTaskSendTcpStringdeflateResetLastUpdateDatecbBrowseIotFile_SceneCurl_compareheadercbIotmDataFileTestdbgDbgDispIptablemutexModifyIotmFiles_dbgShortCut_FindAirCondModelNameIsSourceIdValidCurl_parsenetrciotMakeFileIfNotExist_xPostSchedDelay_iotWrToDisklocaltime_r@@GLIBC_2.4wait@@GLIBC_2.4RegIotDeviceFragManageInitiotRemoveLogicalFileCurl_raw_nequalxPostSchedDelaywiringXSPISetupCurl_connecthostRgbwModeTagToValcurl_formgetchdir@@GLIBC_2.4strcasecmp@@GLIBC_2.4dbgDeployOutdoorCanErrRecdNum_FindAirCondVerbosecurlx_uztosoComboDefault__rawmemchr@@GLIBC_2.4Curl_multi_content_length_penalty_sizeCurl_checkheadersInitJsonObjectCurl_pretransferitemGroupUpdateCurl_free_ssl_configWriteDriverCmddbgXRGBtoHSVdbgRdGpiomutexEmptyFilelumex_message_iotmCheckSerialHwDriverInfo__ashldi3adler32_combineConvIpAddrToBytecbIotmDataNewFilesCurl_pp_moredataRGBW_FindModeTbldeflatedbgSchedualPrintMakeFullPath_XAddMJsonArrayStringForkProcessgeteuid@@GLIBC_2.4func_CT_R1_ARMMiniCmsTcpCmdcompressBoundGetJsonTagValueTokenR1_ReadByteOneGetDinContactModeltblOptionToStopBitReqDinSet_OO_DLperror@@GLIBC_2.4sqlUpdJsonContentIotCanRecvcbIotmSecurityListOpExecCb_tr_stored_block__xstat@@GLIBC_2.4iotPackSelectedFiles_iotDelSceneIfIoRemoveSendUdpDataBin_devPackAltTagpoll@@GLIBC_2.4Curl_HMAC_final_xQSendCurl_wildcard_dtoraccept@@GLIBC_2.4PackFragmentDataFeibitStartRecvtblOptionToLevel_UB_ConvBriToPwmStepmq_close@@GLIBC_2.4cfsetospeed@@GLIBC_2.4IotDevScanNewRemoveSchedByIdxGetCurTimeradxaCanWrite_DO_BufCurl_hostcache_prunedelayMicrosecondsReadBinFromFileMallocDispModelDefault__udivdi3HSVToRGB_iotPackCtrlFileCurl_strntoupper__fxstat64@@GLIBC_2.4inflateMarkIotmCoreTaskReadyCurl_multi_handleCurl_llist_removeiotDelProfilePathpidfile_writesigaction@@GLIBC_2.4stderr@@GLIBC_2.4dbgSchedualRmadler32_combine64itemGroupSearchTagCurl_readrewindradxaValidGPIOR1_InhibitReg_devPackIotInformationCurl_conncache_find_first_connectionInitDriverWriteManagerClrAliveTaskWdt_2fwrite@@GLIBC_2.4devQueryRespCheckR1ModeCurl_httpstrcat@@GLIBC_2.4getsockopt@@GLIBC_2.4Curl_send_plainSendDataToVdpDeviceGetIndoorIptableByIpSubIdCurl_SOCKS4DrvSleepioctl@@GLIBC_2.4cbBrowseIotFile_SearchFeibitGwCurl_version_initTcpServerTaskSendAndRecvUdpCurl_getconnectinfoGetCustomDeviceListlseek64@@GLIBC_2.4Curl_sasl_create_digest_md5_messagestrtoll@@GLIBC_2.4GroupIdGetDinContactModelNameCurl_connected_proxyPackCtrlBProfileusleep@@GLIBC_2.4GetDinCnfgWrFeibit_LearniotLogEventCurl_HMAC_updateiotmPackFileIndoorMasterDeployCurl_share_unlockSendUdpDataCurl_handler_dictCurl_client_chop_writeRdFeibit_ColorDm_iotGetAttrIntReqDinSet_DLLUraspberrypiInittcsetattr@@GLIBC_2.4Curl_creallocwiringXSPIDataRWCurl_setup_transferConvHexStringToBinUpdDevDI_PDN1100Curl_ftp_parselist_data_freeCurl_cookie_clearsessstrcpy@@GLIBC_2.4_RemoveSchedByIdxListOpTravelgettimeofday@@GLIBC_2.4_iotPackFileParacurl_formaddfread@@GLIBC_2.4Curl_pgrsUpdateCurl_initinfoCountCharCurl_closesocketdispIotmFilesAllDriverSendDatacurlx_sitouzIotDevPowerOnSendToIotm__aeabi_i2dAirCondParapthread_create@@GLIBC_2.4dbgRdI2cCancurl_escapeCurl_multi_connchangedCurl_conncache_initraspberrypiValidGPIOwaitForInterruptChkIpAddrValidCtrlbAcceptTcpCmddeflateInit2_dbgDispCanErrRecd_drvModifyDinDev_zCurl_pp_sendfR1_WriteByteCurl_tcpnodelay_iotRemoveFileitemGroupUpdTagIntCurl_MD5_updateSendReadSecurityCurl_httpchunk_initGetJsonArrayMemberTokenCurl_pp_statemachiotRemoveZombieFilegethostname@@GLIBC_2.4Curl_hash_str_iotmPackFiles__aeabi_d2ulz__aeabi_ldiv0TestSceneTaskListOpInsertCurl_ftpsendfAddMJsonSplitStringGetFeibitDevInfoBySubidopendir@@GLIBC_2.4SaveLogIotmFilesAlliotDevStart_FindAirCondProfileCurl_pgrsSetUploadSizeRgbwModeValToTagdeflateParamsParseWrCmdRespCurl_ipvalidhue2rgb__aeabi_drsubAddMJsonOneStringConvHexValueCurl_handler_telnetGetIndoorIptableCurl_pipeline_checkget_readCreateQueueIN_R1_CAN_BUSYStartScanCanDeviceSendTcpBinCreateFeibitDevicejsmn_parseopen64@@GLIBC_2.4Curl_pp_state_timeoutTestSecuritySListOpRemoveRootcurl_strnequalcurl_multi_init_HSVToRGBPackDinNamemutexDbgQuerygetenv@@GLIBC_2.4WriteUtf8FileStartFeibitTaskutf8_get_next_charIsArmingNowLoadActionAlarmdbgList_drvPostObjStringdbgHelpSaveMsgApToDisk__data_startputs@@GLIBC_2.4TcpDriverTaskCurl_posttransferLimitWcharLenWcharCopycurl_multi_add_handlemalloc@@GLIBC_2.4StartSaswellTask_set_tcp_nodelaydeflateSetHeaderHwDriverCntExecActionAlarmdbgChkFileExistdeflateInit_FindFeibitZoneTypeSchdCbSceneGetLumexDevInfo__libc_start_main@@GLIBC_2.4Curl_followhummingboardInitstrerror@@GLIBC_2.4system@@GLIBC_2.4zcfreeMakeFullPathci20SPIGetFdCurl_ssl_backendOpenMsgToDiskCurl_expiremsgrcv@@GLIBC_2.4platformsini_loadhummingboardSPIGetFdGetJsonArrayMemberStringyallociotPackFileParacbBrowseIotFile_NormCurl_init_userdefinedcurl_multi_performCurl_multi_chunk_length_penalty_sizeIsNumStringradxaAnalogReadConvMacToText_SdrvChkGwFoundIptableIndoorCurl_cookie_freelistSearchCanDevPrswiringXI2CWriteReg16_length_code_ConvPwmStepToBriwiringXI2CBlockReadReg8GetJsonArrayMemberIntdbgDrvWriteCmd__aeabi_ul2dMapGetIntcbGetExtCmdwiringXISRraspberrypiSPIDataRWCurl_pgrsStartNowcurl_share_setoptTestSceneTaskExecCurl_doing_getsockCheckFragmentTTLcurl_share_cleanup_iotmGetFileBySerialCurl_ftp_parselist_geterrorCurl_multi_max_host_connectionsSetDbgLevelCurl_clone_ssl_config__ctype_tolower_loc@@GLIBC_2.4ParseIptable__ctype_toupper_loc@@GLIBC_2.4CloseFeibitSocketcurl_strequal__gmon_start__Curl_add_buffer_freeIotCmdInfoCurl_disconnectopen@@GLIBC_2.4GetRef_msCheckIndoorOnLineSearchTokenByListSendLocalUartCurl_cookie_add_PostCurSecmake_unicode_stringMJsonCopyCurl_pgrsTimeDbgMsgTime__udivsi3__dso_handleCurl_fileinfo_allocwiringXSerialGetChar__ctype_b_loc@@GLIBC_2.4Curl_fileinfo_dtorCbDef_Daikingetcwd@@GLIBC_2.4getpid@@GLIBC_2.4ClrAliveTaskWdtCnt_1exit@@GLIBC_2.4curl_easy_resetcurlx_ultosicbIotmDataFile__aeabi_llslWrFeibit_RemoveCurl_pgrsSetDownloadCounterAttr_AddItemCurl_add_buffer_senddbgSchedualRmIdxsysLogPrintfdrvDbgTurnPause__aeabi_llsrLoadIniFiledbg_drvUpdIotParadefaultFragFinishCurl_verboseconnectdbgRdDevPoolIsIndoorIdReadTextFromSysDircurl_global_init_memCurl_hostcache_cleanGetJsonTagValueMallocStringfunc_CT_R1_DO4_IO_stdin_usedCurl_printable_addressSysLastUpdateSecsorangepiValidGPIO_InitSchedIdConvFormatStringRdFeibit_OopinflateSyncPointPingDestI2cReadDbgMsgTestSocketWriteManagerCurl_if_is_interface_namecurlx_sltosifunc_CT_R1_DO2SchedualTaskInfodbgWrDinCmdinflateEndinflate_fastStartCanErrRecdDrvAcceptTcpCmdstrtoul@@GLIBC_2.4_xMboxRecvSplitSradxaInitstrlen@@GLIBC_2.4SetIotkParaArmLedFileCurl_base64_encode_atohdbgLoadAirCondTxtCurl_getaddrinfoCurl_pp_readrespmmap@@GLIBC_2.4IotModifyCountercurl_easy_duphandleCurl_ipv6_scopeRegIotToCmsRespTag_1__aeabi_d2lzstrchr@@GLIBC_2.4UpdDevDI_Curtain_zcurl_multi_setoptCurl_protocol_connecttblOptionToBaudRatecurlx_nonblockUpdDevDI_PDN1140_zRegFeibitIotDeviceOnLineCheckwiringXSerialClosecurlx_tvdiff_secsR1_ScanAllNewDevicemq_open@@GLIBC_2.4PostDeployDisarmR1_WriteBuff_AinflateSetDictionaryPackMJsonStringCurl_pgrsSetUploadCounterSepStringTestIndoorIpini_get_truthset_nonblockListOpGetLengthCurl_dupsetadler32_devPackDriverInfoInitIptableCurl_hash_deletedevPackIotInfodeflateBoundCurl_add_bufferitemGroupSearchiotRs485Info_RGBToHSVAddMJsonIntCanAccessNumAttachTextCPzlibUncomprCurl_MD5_initfprintf@@GLIBC_2.4AddMJsonArrayIntraspberrypiSPIGetFddbgFindFeibitcurlx_uztouiitemSetStringdbgDbgLvlActiveGetIp_RS485hummingboardValidGPIOtblOptionToLevel_GwTypeCurl_rtsp_parseheaderUpdDevDI_CurtainPackDinCmdcfsetispeed@@GLIBC_2.4ClrTcpMonitordbgDispMutexCurl_pipeline_server_blacklistedIptableIotm__divsi3StartPml1000TaskCurl_cache_addrR1CanDevNumUpdCtrlSelItemCurl_proxy_connectitemGetFloatdispIotmFilechown@@GLIBC_2.4TeSetLumexDatacurl_multi_waitdbgIotkSendFilestdin@@GLIBC_2.4fcntl@@GLIBC_2.4ReadUtf8volk_messageCurl_timeleftiotDevRemove__libc_csu_initPackJobjIntArraydbgScanNewCanDevConvMacToText__subdf3make_utf8_string_xiotMakeFilepthread_attr_init@@GLIBC_2.4Curl_splaygetbestsqlUpdDevNameNoteCurl_copy_header_valueusPerCharSendRemoteUartFragmentBlockSizeCurl_handler_ftpmutexIotCurl_sasl_parse_url_auth_option__errno_location@@GLIBC_2.4RemoveAirCondFiledbgDeployDisarmCurl_hash_start_iterateAddFeibitSimpleAddMJsonHex4Curl_sasl_digest_cleanupCurl_handler_fileSendWriteManagerinflateGetHeaderdrvAddCustomstrncasecmp@@GLIBC_2.4func_CT_R1_DI2AddMJsonObj__isoc99_sscanf@@GLIBC_2.7curl_global_init_iotmGetEmptyFiledbgIotReleaseMakeLumexDevmkdir@@GLIBC_2.4bind@@GLIBC_2.4ChkBgProcessStartGigaIotTaskcurlx_ultoucfunc_CT_R1_DI4_ArmLedOnReadTextFileSysProftgetgid@@GLIBC_2.4AddNewDevMacCurl_http_input_authReadBinFromFileCustomDrvIPiotPackModifyFilesUpdDevDI_RGBWzlibComprCurl_cookie_getlistInitTestSceneTaskmemset@@GLIBC_2.4wiringXSerialPutsInitDriverTaskcurl_easy_sendini_get_intGetIndoorMasterPwutf8_print_each_charUpdDevDI_OOChkWriteEventIme_endCurl_pgrsResetTimesSizesCurl_multi_pipelining_site_blStartAlarmNotifyTaskdbgDrvSleepcbGetOnlineinflatePrimeCurl_conncache_add_connputchar@@GLIBC_2.4strncpy@@GLIBC_2.4Curl_multi_handlePipeBreakcurl_easy_initUpdDevDI_PSW1070_devGetFileByIptid_iotmUpdateFileConsoleCmd_iotmNewFiledrvDbgTurnOn__xpg_basename@@GLIBC_2.4hummingboardSPISetupAddEth0EhomeIpAddr_startmutexR1jsmn_inititemCreateCurl_sasl_build_spnCurl_recv_plainCurl_monthcurl_multi_socketProcessSceneTimer_iotExecSceneFilemutexSchdCurl_MD5_finalFindFeibitSimpleCurl_fnmatchgSecudbgIotkSendTestFileDbgMsgUpdDevDI_PDN1120ini_put_entryConvStringToBiniotfVersiondrvModifyDinDev_zCurl_add_buffer_initCurl_conncache_find_bundleitemGroupUpdTagStringpthread_attr_getstacksize@@GLIBC_2.4StartNonBlockingNetTaskCurl_pgrsSetDownloadSizecurlx_ultousdbgIotDelSceneFilePostFragBlockstrtod@@GLIBC_2.4SendRqIotTestUpdDevDI_DI_TrigCurl_str_key_comparewrite@@GLIBC_2.4dbgIotQuerydbgHSVtoRGBfileno@@GLIBC_2.4dispIotmSceneFilesinfoGigaDrvTaskdeflateEndCreateLumexDeviceStartRecvCmdIotFlushCountercurl_easy_strerrorAddMJsonObjStringauchCRCHiiotmNewFileCurl_hash_pickCurl_checkProxyheaderscurl_msnprintfpinModeCurl_llist_destroyIN_R1_INTRcurl_getenvCurl_removeHandleFromPipeline__end__dbgSqlSelectMakeProfilePath_devPackIotInfoCurl_sasl_digest_get_pairCurl_base64_decodeCurl_pop3_writeFreePackFragInfoCanErrRecorddrv_Register__aeabi_idiv0dbgXHSVtoRGBSendResponseCurl_updateconninfoMainTestFunc_DriverSendDataCurl_pipeline_wantedCurl_input_digestdevGetModelDefaultByDevidmemchr@@GLIBC_2.4ExecBuzzervsprintf@@GLIBC_2.4_iotMakeLogicItemMapStringR2LQSendPktGetFeibitDevInfoAddWriteEventImeReqDinSet_DOrand@@GLIBC_2.4_MakeFileByDevidStartIotTaskcurl_msprintfwiringXI2CBlockWriteReg16iotUpdFileNameByIptinflateCopystdout@@GLIBC_2.4ReadTextByFileNumRdCustomDevCnt_xMboxSenddbgShortCut_xCurl_HMAC_initIotmUdpSearch__bss_startfclose@@GLIBC_2.4_SYSEXITiotmGetFileBySerialCurl_conncache_foreachpthread_exit@@GLIBC_2.4curl_easy_pausedbgShortCut_zCurl_ssl_config_matchesdrvUnlinkDevtblOptionToParityStartCurtainTaskPml1000UpdIoUpdDevDI_DI_Trig_zqIot__floatsidfdevPrintModelAttrVerbosedbgIotkTestScene__lshrdi3mainCurl_meets_timeconditionupperR1VerMinordbgWriteFilexDbgTag_ConvWeekTextToBitiotRemoveLogChkMacAddrValidIotCanSendini_freedrvDbgTurnQueryCurl_set_dns_interfaceinflateInit_Curl_wait_msR1_ReadBuffCurl_http_setup_conndbgFeibitBIotRegCmsCounter_drvIotDevPostSetIotPwCurl_cookie_initDbgPutStringCurl_cstrdupwiringXI2CWriteCurl_flush_cookiesdeflatePendingPackJobjUnRegIotDevFileNewDelFlushCount_strncpyLoadAirCondPerformanceraspberrypiCurl_sendfConvSecToDateRGBToHSV_255xDbgPtdbgDbgLvlDeactivemunmap@@GLIBC_2.4DevStatusCurl_handler_rtspCurl_handler_gopherorangepiInitdeflateCopyRs485LedPrsMapDriverCmdstrtok@@GLIBC_2.4PostDeployIndoorcbIotmDataDelFilesStopIotmCoreTaskinflate_tablecurl_mprintfcurl_share_strerrorsendto@@GLIBC_2.4ReadUtf8WorkingDirwiringXI2CWriteReg8Curl_getinfosqlUpdJsonOptionUpdDevDI_DICurl_GetFTPResponsecurl_share_initCrc16VerifyCurl_pipeline_checkget_writeReadTextDefaultiotIR_AlarmRGBToHSL_255popen@@GLIBC_2.4crc32_combinemq_receive@@GLIBC_2.4Curl_setup_conncurl_multi_assignDispIptable_xListOpTravelCurl_sasl_cleanupdevQuerySleepCurl_getoff_all_pipelinesfork@@GLIBC_2.4Curl_llist_insert_nextcompress2curlx_sltousWriteAirCondFile__xpg_strerror_r@@GLIBC_2.4Curl_smtp_escape_eobcurl_mfprintfCurl_pollcurlx_uztoszcurl_mvfprintfControlBoardBroadcastcurl_versionCurl_gmtimeWrFeibit_IRJsonSecurityFileci20SPISetupDbgMsgLeveldevPackIotInformationreaddir@@GLIBC_2.4infoDrvTaskGetIotIptablefragPostTcpSysPwstrrchr@@GLIBC_2.4curl_unescapeIotkIpwiringXValidGPIO_iotPackFileParaDirtylisten@@GLIBC_2.4Curl_he2aiget_profile_cntvfprintf@@GLIBC_2.4R1TickTaskRgbwModeTblCurl_single_getsockcbIotmDataFilescurlx_tvdiffcurl_slist_free_allci20SPIDataRWAlarmNotifyTask__floatundidfcurlx_sltouiSysLogServerIpitemGetIntCurl_cookie_clearallI2cWriteCurl_llist_moveRemoteConsoleCmdPrsCurl_http_output_authwiringXSerialFlushClrWdt_execAddMJsonArrayObjCurl_freeaddrinfo__sigsetjmp@@GLIBC_2.4logicCompareCurl_add_custom_headersCurl_hash_next_elementUpdLumexDevwiringXI2CReadReg16func_CT_R1_GASCurl_splayremovebyaddrCanWrite_SayHiAddNewGwSnInitTextCPfputc@@GLIBC_2.4r1_initCurl_http_auth_actinflateInit2_MapGetStringiotRegProfilePathdbgDeployIndoorInitTcpServer__aeabi_uidivmodGetHexValuedbgLediotPackCtrlFullListConvBroadcastIpzcallocAirCondRdPerformanceCntCalcWcharLensqlUpdDeviceNoteTestCloseSocketcurl_jmpenvInitJsonAllVarCurl_fillreadbufferxallocGetTokenString_Jv_RegisterClassescurl_multi_cleanupCheckWdt_execcurl_multi_timeoutConvProfileTextdbgWriteSpcialSceneCurl_global_host_cache_dtor_tr_alignCurl_wkdayLocalIp_iotmPackFileFragPktPoolCurl_sasl_continueDev_AddItemwiringXSerialPutCharCurl_getaddrinfo_exCurl_handler_imapsprintf@@GLIBC_2.4wiringXSPIGetFdCurl_cookie_loadfilesGetLumexAppsCurl_gethostnameGetJsonTagValueIntCloseMsgToDisklogicStrdrvAddCtrlbdrvGetIotParaiotkActiveFreeSplitString_xQRecvxtrcpyCurl_wildcard_initCurl_pipeline_leave_writeRegWdtCurl_write_plainGetLocalIpSysLogActivecurl_mvprintfgetsockname@@GLIBC_2.4Curl_multi_process_pending_handlesCurl_handler_pop3iotDevCoupleCounterCreateQueuePktRGBToHSVDriverWriteManagerTaskVerboseAppendraspberrypiSPISetupCurl_http_connectCurl_cookie_listCurl_ack_eintrdbgDispSecuritydbgInfo1PostFinalDataCurl_move_handle_from_send_to_recv_pipeStartGigatechIpNotifyTaskCurl_http_donedrvAddDevKillZllGatewaydbgShortCut_vCurl_slist_append_nodupitemSetFloatGenBuildTimeSearchOrPiGpioremove@@GLIBC_2.4drvAddAirCondvsnprintf@@GLIBC_2.4curlx_tvnowUpdDevDI_R1_zForceIotfFlushStartSecurityTask__fixunsdfdifopen64@@GLIBC_2.4ConvShortToLittleEndianqsort@@GLIBC_2.4__fixdfdiGigaDrvTaskdbgRGBtoHSL_iotPickCtrlTypeError_I2citemGroupDisplaygetpeername@@GLIBC_2.4RegRemoteConsoleCmdinflateResetiotkQSendListOpRemoveDatadrvAddDevFeibitLumexGetEmptyIRCurl_SOCKS5Curl_blockread_allzlibVersionExecJsonStringCbPackDinNameByFileCurl_formcleanConvTextToMac_fprintfiotAddLogLumexRegIRSendWrSecurityDinCnfg_R1_Pdn1180ParseFormatJsonData_drvPostAltDataR1_ReadByteClrWdtCurl_freesetCurl_init_CONNECTCurl_add_timeconditioncurl_multi_socket_allmsgget@@GLIBC_2.4PostEventToSecuritycurl_mvsnprintfdevGetVerbosecurl_multi_socket_actionmq_getattr@@GLIBC_2.4Curl_docurl_mvaprintfiotRegProfileGetHexAscz_errmsgdbgInputDatadbgKillZllGatewayfreeaddrinfo@@GLIBC_2.4Curl_protocol_doingCurl_sasl_startgetaddrinfo@@GLIBC_2.4curl_easy_setoptCombineSqlOptiondbgWrSecurityDownLoadOnlineInfocurl_getdateinet_ntop@@GLIBC_2.4ExecZllGatewayCurl_init_docbRemoteConsolefunc_CT_R1_MAXsocket@@GLIBC_2.4fmod@@GLIBC_2.4devPackContentSeperateString__TMC_END__ScanCanDevAutoStartCntGetIndoorIptableByIpCreateSpecialSceneFiledeflateResetKeepclock_gettime@@GLIBC_2.4valDatabitCurl_resolv_timeoutAddMJsonTimeDbgLvl__aeabi_idivdbgIotkQueryUpdDevDI_PDN1140inflateReset2Curl_client_writeGetCurTimeStringCheckCmsOnlineatof@@GLIBC_2.4CheckFileExistdbgDispControlBoardCurl_donedbgLvlInsideTestFunciotIR_sendPropertyEM2110ci20ValidGPIOmq_unlink@@GLIBC_2.4_ModifySceneEventxDbgTagXCurl_resolv_unlock_ITM_registerTMCloneTableCalcChkSum_iotRemoveAttachSceneCurl_debugCurl_randCurl_conncache_destroyBuzzerAutoOffPrsConvLittleEndianToShortCurl_pp_disconnectinet_addr@@GLIBC_2.4iotPackNewProftPacket_dist_codecurl_multi_strerrorCurl_multi_add_performCurl_hash_destroyCurl_readwriteRange_PackStartmutexDevWriteSysIni_xOpenJsonSetsCurl_sasl_initDbgMsgFCurl_md5itiotDevDisplayCurl_tvlongDispModelDefxPostSchedTimedbgExecZllGatewaywiringXI2CBlockWriteCurl_cookie_cleanupif_nametoindex@@GLIBC_2.4curl_easy_cleanupRegIotDeviceDinConvFeibitSnvalParity_PackDevCnfg_RegIotFileToCmsdbgReadSecuritycurl_easy_recvCurl_resolvLoadAirConditionProfileDbgMsgMsCmsUpdateContentByIptid_FindAirCondBasicTypeSetLumexParaCurl_persistconninfoci20ParseHuaYueTcpCmdClrAliveTaskWdtCnt_2fseek@@GLIBC_2.4wiringXSerialPrintfTestSceneIntervaldbgInfo__xstat64@@GLIBC_2.4GetWorkingDirRemoveSchedCurl_is_connecteddeflateSetDictionaryGetDbgNameWdtInfoInitFragPktdbgLvlHelpzlibCompileFlagsCurl_speedcheckinfoDrvTaskCntpthread_attr_setdetachstate@@GLIBC_2.4_ArmLedOffGetCurTimeFullStringmsgsnd@@GLIBC_2.4__aeabi_dadddbgWrWdtOffdbgIotkBlkSize_dispIotmFileInitConnectionitemGetHexCurl_ftp_parselist__floatunsidfintBaudrateiotQBusyCurl_num_addresses_FindAirCondSysTagHSVToRGB_255UpdateJsonVarlowerdevGetModelBasicTypeStartIotmCoreTask_tr_flush_bitsdbgDispR1CnfgCombo_AddItemfputs@@GLIBC_2.4strncmp@@GLIBC_2.4wiringXSerialDataAvailGetIotPw_xDbgMsgBiniotRs232InfoCurl_sasl_decode_mechtblOptionToLevel_POWERStartSchedualTaskTickdbgWrDinReset_SaveSysPwcurlx_sotouzini_newCurl_speedinitRegMutexForDispinflateSyncabort@@GLIBC_2.4DownLoadIptableSetDbgByName__aeabi_ui2di2cfdGetJsonTagValueFloatIsSecurityZoneCurl_ccallocIotCanSend_R1iotDevJoinInitTcpServerMonitorrecv@@GLIBC_2.4Curl_add_handle_to_pipeline_iotPackDirtyFilessiglongjmp@@GLIBC_2.4zallocdbgWrDO_initclose@@GLIBC_2.4iotGetAttrStringBySerialGetJsonTagValueStringCurl_pgrsDoneCheckIptableValidateGetJsonArraySizesend@@GLIBC_2.4iotDevCoupleStartdeflateTunedbgUpdateAttr__extendsfdf2dbgIotkSendGetCnfgmq_send@@GLIBC_2.4connect@@GLIBC_2.4UpdDevDI_RGBW_zclosedir@@GLIBC_2.4sqlDeleteAllDeviceiotmUpdParaByDrvtblOptionToLevel_LBCurl_DIGEST_MD5UpdDevDO_R1iotDevInittestWrLogmechtableCurl_httpchunk_readCurl_read_plaindbgShortCut_cdevQueryMsgCnt__aeabi_l2d_iotmGetExistFileGroupSubIdstrspn@@GLIBC_2.4DebugConsoleGetEmptyAirCondParaCurl_str2addrGetModelIptableUdpListenTaskSetDbgMsgSearchMacRowtcgetattr@@GLIBC_2.4Curl_FormReaderdevGetModelDefaultSendReadSecurityArmCurl_memrchrIgnoreSpaceNameWrFeibit_LockxQueIpcIdxMsgLoadNewSecurityFilepclose@@GLIBC_2.4DispGwRespsqlUpdRs485ContentCombo_PackStartUpdDevDI_PDN1100_zCurl_pp_flushsend44#PP 1opp$; p CKoXoDDg (p B0 y,#,# t8#8# + +dp  ( ( , , 0 0 4 4 8 8 8 8 L L 0^ | 880| pQ 5 (  y a  ,t 90 D O=# 0m# ]$ d$ ̈ B